Thợ đào Bitcoin rút 485 triệu USD khi BTC chật vật giữ mức 112.000 USD; Dấu hiệu cảnh báo?

Coin369
29/08/2025 11:03
Thợ đào Bitcoin rút 485 triệu USD khi BTC chật vật giữ mức 112.000 USD; Dấu hiệu cảnh báo?

Bitcoin đã lấy lại mốc 112.000 USD vào thứ Năm, phục hồi từ mức thấp nhất trong sáu tuần chỉ hai ngày trước đó. Bất chấp đà phục hồi, các nhà giao dịch vẫn lo ngại khi các thợ đào Bitcoin đang bán tháo với tốc độ nhanh nhất trong chín tháng. Câu hỏi đặt ra là liệu điều này có báo hiệu sự khởi đầu của một cuộc khủng hoảng sâu sắc hơn hay còn các yếu tố nào khác đang thúc đẩy dòng tiền chảy ra gần đây.

Lưu lượng ròng trung bình 5 ngày của thợ đào Bitcoin, BTC. Nguồn: Glassnode

Ví của thợ đào được Glassnode theo dõi cho thấy sự sụt giảm đều đặn từ ngày 11 tháng 8 đến ngày 23 tháng 8, và hầu như không có dấu hiệu tích lũy trở lại kể từ đó. Đợt rút tiền liên tục gần nhất vượt quá 500 BTC mỗi ngày là vào ngày 28 tháng 12 năm 2024, sau khi Bitcoin liên tục không giữ được trên 97.000 USD.

Số dư thanh khoản của thợ đào Bitcoin, BTC. Nguồn: Glassnode.

Trong đợt bán tháo gần đây nhất, các thợ đào đã bán ra 4.207 BTC, trị giá khoảng 485 triệu USD, trong khoảng thời gian 12 ngày kết thúc vào ngày 23 tháng 8. Con số này trái ngược với giai đoạn tích lũy trước đó từ tháng 4 đến tháng 7, khi các thợ đào bổ sung 6.675 BTC vào dự trữ. Số dư của các thợ đào hiện ở mức 63.736 BTC, trị giá hơn 7,1 tỷ USD.

Mặc dù dòng tiền này tương đối nhỏ so với các khoản phân bổ từ các công ty như MicroStrategy (MSTR) và Metaplanet (MTPLF), nhưng chúng có xu hướng thúc đẩy đầu cơ thị trường và tâm lý FUD. Nếu các công ty khai thác phải đối mặt với dòng tiền eo hẹp hơn, áp lực bán có thể gia tăng trừ khi lợi nhuận được cải thiện.

Trong chín tháng qua, Bitcoin đã tăng 18%, nhưng lợi nhuận của thợ đào đã giảm 10%, theo dữ liệu của HashRateIndex. Độ khó khai thác tăng cao và nhu cầu giao dịch onchain yếu hơn đã ảnh hưởng đến biên lợi nhuận. Mạng lưới Bitcoin tiếp tục tự điều chỉnh để hỗ trợ khoảng thời gian khối trung bình là 10 phút, nhưng lợi nhuận vẫn là một mối lo ngại.

Chỉ số giá hashrate Bitcoin, PH/giây. Nguồn: HashRateIndex.

Chỉ số giá băm Bitcoin hiện ở mức 54 PH/giây, giảm so với mức 59 PH/giây của một tháng trước. Tuy nhiên, các thợ đào khó có thể phàn nàn: chỉ số này đã cải thiện đáng kể so với mức hồi tháng 3. Theo dữ liệu của NiceHash, ngay cả các giàn khai thác S19 XP của Bitmain từ cuối năm 2022 vẫn có lãi ở mức 0,09 đô la mỗi kWh.

Những người khai thác Bitcoin phải đối mặt với sự cạnh tranh của AI nhưng vẫn kiên cường

Một số nhà đầu tư tỏ ra thất vọng do sự chuyển dịch ngày càng mạnh mẽ sang cơ sở hạ tầng trí tuệ nhân tạo (AI). Câu chuyện này càng được chú ý sau khi TeraWulf (WULF) đạt được thỏa thuận trị giá 3,2 tỷ USD với Google để đổi lấy 14% cổ phần. Khoản tiền này sẽ được sử dụng để mở rộng khuôn viên trung tâm dữ liệu AI của TeraWulf tại New York, dự kiến ​​đi vào hoạt động vào nửa cuối năm 2026.

Các công ty khai thác khác cũng đang theo đuổi một hướng đi tương tự. Công ty Iren của Úc, trước đây gọi là Iris Energy, đã đẩy nhanh việc mua lại GPU Nvidia và đang xây dựng một trung tâm dữ liệu AI làm mát bằng chất lỏng tại Texas, cùng với một cơ sở mới ở British Columbia có sức chứa tới 20.000 GPU. Trong khi đó, Hive, trước đây là Hive Blockchain, đã cam kết đầu tư 30 triệu USD để mở rộng hoạt động sử dụng GPU tại Quebec.

Tỷ lệ băm khai thác Bitcoin, TH/giây. Nguồn: Blockchain.com.

Bất chấp những ồn ào xung quanh AI, nền tảng cơ bản của Bitcoin vẫn vững chắc. Hashrate mạng lưới đang tiến gần đến mức cao nhất mọi thời đại là 960 triệu TH/giây, tăng 7% trong ba tháng qua. Sức mạnh này đã xoa dịu nỗi lo về dòng tiền ròng chảy ra của thợ đào hoặc việc thiếu lợi nhuận trên toàn ngành.

Không có bằng chứng nào cho thấy các công ty khai thác đang chịu áp lực phải thanh lý các vị thế ngay lập tức và ngay cả khi việc bán tiếp tục, dòng tiền đổ vào dự trữ của công ty vẫn có khả năng chống lại tác động này.

Tags: Bitcoin
Laminas
Documentation Modules Gallery PHP Version 8.2.29 Extensions intl ModulesLaminas\MailLaminas\DeveloperToolsLaminas\SerializerLaminas\I18nLaminas\Mvc\Plugin\FlashMessengerLaminas\LogLaminas\SessionLaminas\CacheLaminas\PaginatorLaminas\FormLaminas\InputFilterLaminas\FilterLaminas\HydratorLaminas\DbLaminas\RouterLaminas\ValidatorDoctrineModuleDoctrineORMModuleLaminas\Cache\Storage\Adapter\FilesystemLaminas\Cache\Storage\Adapter\MemoryDoctrineMongoODMModuleLaminas\Cache\Storage\Adapter\RedisApplicationAdminRestful
Request and Response 200 Application.HomeController::news on application.appnews
Status code 200 Method GET Controller Application.HomeController Action news Other Route Parameters
 array:2 [
  "method" => "detail"
  "param" => "tho-dao-bitcoin-rut-485-trieu-usd-khi-btc-chat-vat-giu-muc-112000-usd-dau-hieu-canh-bao"
]
Route application.appnews Template layout/layout

  Seo_content: array
  content: string
  is_layout: int

Template application/home/newsdetail.phtml

  Ads: array
  MrData: string
  TDetail: Admin\Entity\System\SysNews
  my_id: string
  newsCategories: array
  relatedNews: array

Execution Time 1.57 s
1. route 50.79 ms
File: public/index.php - Line: 127
Target: Laminas\Mvc\Application
2. dispatch 87.21 ms
File: public/index.php - Line: 127
Target: Laminas\Mvc\Application
3. dispatch 1.28 s
File: src/DispatchListener.php - Line: 117
Target: Application\Controller\HomeController
4. render 1.37 s
File: src/Application.php - Line: 335
Target: Laminas\Mvc\Application
5. renderer 1.37 s
File: Http/DefaultRenderingStrategy.php - Line: 92
Target: Laminas\View\View
6. renderer.post 1.37 s
File: Http/DefaultRenderingStrategy.php - Line: 92
Target: Laminas\View\View
7. renderer 1.37 s
File: src/View.php - Line: 230
Target: Laminas\View\View
8. renderer.post 1.37 s
File: src/View.php - Line: 230
Target: Laminas\View\View
9. response 1.57 s
File: Http/DefaultRenderingStrategy.php - Line: 92
Target: Laminas\View\View
10. finish 1.57 s
File: src/Application.php - Line: 335
Target: Laminas\Mvc\Application
11. collected 4.14 s
File: Listener/ProfilerListener.php - Line: 79
Target: NULL
Total Time 1.57 s
Memory Peak 4.00 MB
1. route 2.00 MB

public/index.php - Line: 127

2. dispatch 2.00 MB

public/index.php - Line: 127

3. dispatch 2.00 MB

src/DispatchListener.php - Line: 117

4. render 2.00 MB

src/Application.php - Line: 335

5. renderer 2.00 MB

Http/DefaultRenderingStrategy.php - Line: 92

6. renderer.post 2.00 MB

Http/DefaultRenderingStrategy.php - Line: 92

7. renderer 2.00 MB

src/View.php - Line: 230

8. renderer.post 2.00 MB

src/View.php - Line: 230

9. response 4.00 MB

Http/DefaultRenderingStrategy.php - Line: 92

10. finish 4.00 MB

src/Application.php - Line: 335

11. collected 6.00 MB

Listener/ProfilerListener.php - Line: 79

Memory Peak 4.00 MB
Config Config
Merged Config (Config)
 array:44 [
  "service_manager" => array:5 [
    "aliases" => array:37 [
      "Zend\Mail\Protocol\SmtpPluginManager" => "Laminas\Mail\Protocol\SmtpPluginManager"
      "TranslatorPluginManager" => "Laminas\I18n\Translator\LoaderPluginManager"
      "Zend\I18n\Translator\TranslatorInterface" => "Laminas\I18n\Translator\TranslatorInterface"
      "Zend\I18n\Translator\LoaderPluginManager" => "Laminas\I18n\Translator\LoaderPluginManager"
      "Laminas\I18n\Geography\CountryCodeListInterface" => "Laminas\I18n\Geography\DefaultCountryCodeList"
      "Laminas\Translator\TranslatorInterface" => "Laminas\I18n\Translator\TranslatorInterface"
      "Zend\Log\Logger" => "Laminas\Log\Logger"
      "Laminas\Session\SessionManager" => "Laminas\Session\ManagerInterface"
      "Zend\Session\SessionManager" => "Laminas\Session\SessionManager"
      "Zend\Session\Config\ConfigInterface" => "Laminas\Session\Config\ConfigInterface"
      "Zend\Session\ManagerInterface" => "Laminas\Session\ManagerInterface"
      "Zend\Session\Storage\StorageInterface" => "Laminas\Session\Storage\StorageInterface"
      "Zend\Paginator\AdapterPluginManager" => "Laminas\Paginator\AdapterPluginManager"
      "Zend\Paginator\ScrollingStylePluginManager" => "Laminas\Paginator\ScrollingStylePluginManager"
      "Laminas\Form\Annotation\AnnotationBuilder" => "FormAnnotationBuilder"
      "Laminas\Form\Annotation\AttributeBuilder" => "FormAttributeBuilder"
      "Laminas\Form\FormElementManager" => "FormElementManager"
      "InputFilterManager" => "Laminas\InputFilter\InputFilterPluginManager"
      "Zend\InputFilter\InputFilterPluginManager" => "Laminas\InputFilter\InputFilterPluginManager"
      "FilterManager" => "Laminas\Filter\FilterPluginManager"
      "Zend\Filter\FilterPluginManager" => "Laminas\Filter\FilterPluginManager"
      "HydratorManager" => "Laminas\Hydrator\HydratorPluginManager"
      "Zend\Hydrator\HydratorPluginManager" => "Laminas\Hydrator\HydratorPluginManager"
      "Zend\Hydrator\StandaloneHydratorPluginManager" => "Laminas\Hydrator\StandaloneHydratorPluginManager"
      "Laminas\Db\Adapter\Adapter" => "Laminas\Db\Adapter\AdapterInterface"
      "Zend\Db\Adapter\AdapterInterface" => "Laminas\Db\Adapter\AdapterInterface"
      "Zend\Db\Adapter\Adapter" => "Laminas\Db\Adapter\Adapter"
      "HttpRouter" => "Laminas\Router\Http\TreeRouteStack"
      "router" => "Laminas\Router\RouteStackInterface"
      "Router" => "Laminas\Router\RouteStackInterface"
      "RoutePluginManager" => "Laminas\Router\RoutePluginManager"
      "Zend\Router\Http\TreeRouteStack" => "Laminas\Router\Http\TreeRouteStack"
      "Zend\Router\RoutePluginManager" => "Laminas\Router\RoutePluginManager"
      "Zend\Router\RouteStackInterface" => "Laminas\Router\RouteStackInterface"
      "Laminas\Validator\Translator\TranslatorInterface" => "Laminas\Validator\Translator\Translator"
      "ValidatorManager" => "Laminas\Validator\ValidatorPluginManager"
      "Zend\Validator\ValidatorPluginManager" => "Laminas\Validator\ValidatorPluginManager"
    ]
    "factories" => array:89 [
      "Laminas\Mail\Protocol\SmtpPluginManager" => "Laminas\Mail\Protocol\SmtpPluginManagerFactory"
      "SerializerAdapterManager" => "Laminas\Serializer\AdapterPluginManagerFactory"
      "Laminas\Serializer\AdapterPluginManager" => "Laminas\Serializer\AdapterPluginManagerFactory"
      "Laminas\Serializer\Adapter\AdapterInterface" => Laminas\Serializer\GenericSerializerFactory {#41
        -serializerName: "Laminas\Serializer\Adapter\PhpSerialize"
        -options: null
      }
      "Laminas\I18n\Translator\TranslatorInterface" => "Laminas\I18n\Translator\TranslatorServiceFactory"
      "Laminas\I18n\Translator\LoaderPluginManager" => "Laminas\I18n\Translator\LoaderPluginManagerFactory"
      "Laminas\I18n\Geography\DefaultCountryCodeList" => array:2 [
        0 => "Laminas\I18n\Geography\DefaultCountryCodeList"
        1 => "create"
      ]
      "Laminas\Log\Logger" => "Laminas\Log\LoggerServiceFactory"
      "LogFilterManager" => "Laminas\Log\FilterPluginManagerFactory"
      "LogFormatterManager" => "Laminas\Log\FormatterPluginManagerFactory"
      "LogProcessorManager" => "Laminas\Log\ProcessorPluginManagerFactory"
      "LogWriterManager" => "Laminas\Log\WriterPluginManagerFactory"
      "Laminas\Session\Config\ConfigInterface" => "Laminas\Session\Service\SessionConfigFactory"
      "Laminas\Session\ManagerInterface" => "Laminas\Session\Service\SessionManagerFactory"
      "Laminas\Session\Storage\StorageInterface" => "Laminas\Session\Service\StorageFactory"
      "Laminas\Cache\Storage\AdapterPluginManager" => "Laminas\Cache\Service\StorageAdapterPluginManagerFactory"
      "Laminas\Cache\Storage\PluginManager" => "Laminas\Cache\Service\StoragePluginManagerFactory"
      "Laminas\Cache\Service\StoragePluginFactory" => "Laminas\Cache\Service\StoragePluginFactoryFactory"
      "Laminas\Cache\Service\StoragePluginFactoryInterface" => "Laminas\Cache\Service\StoragePluginFactoryFactory"
      "Laminas\Cache\Service\StorageAdapterFactory" => "Laminas\Cache\Service\StorageAdapterFactoryFactory"
      "Laminas\Cache\Service\StorageAdapterFactoryInterface" => "Laminas\Cache\Service\StorageAdapterFactoryFactory"
      "Laminas\Cache\Command\DeprecatedStorageFactoryConfigurationCheckCommand" => "Laminas\Cache\Command\DeprecatedStorageFactoryConfigurationCheckCommandFactory"
      "Laminas\Paginator\AdapterPluginManager" => "Laminas\Paginator\AdapterPluginManagerFactory"
      "Laminas\Paginator\ScrollingStylePluginManager" => "Laminas\Paginator\ScrollingStylePluginManagerFactory"
      "FormAnnotationBuilder" => "Laminas\Form\Annotation\BuilderAbstractFactory"
      "FormAttributeBuilder" => "Laminas\Form\Annotation\BuilderAbstractFactory"
      "FormElementManager" => "Laminas\Form\FormElementManagerFactory"
      "Laminas\InputFilter\InputFilterPluginManager" => "Laminas\InputFilter\InputFilterPluginManagerFactory"
      "Laminas\Filter\FilterPluginManager" => "Laminas\Filter\FilterPluginManagerFactory"
      "Laminas\Hydrator\HydratorPluginManager" => "Laminas\Hydrator\HydratorPluginManagerFactory"
      "Laminas\Hydrator\StandaloneHydratorPluginManager" => "Laminas\Hydrator\StandaloneHydratorPluginManagerFactory"
      "Laminas\Db\Adapter\AdapterInterface" => "Laminas\Db\Adapter\AdapterServiceFactory"
      "Laminas\Router\Http\TreeRouteStack" => "Laminas\Router\Http\HttpRouterFactory"
      "Laminas\Router\RoutePluginManager" => "Laminas\Router\RoutePluginManagerFactory"
      "Laminas\Router\RouteStackInterface" => "Laminas\Router\RouterFactory"
      "Laminas\Validator\Translator\Translator" => "Laminas\Validator\Translator\TranslatorFactory"
      "Laminas\Validator\ValidatorPluginManager" => "Laminas\Validator\ValidatorPluginManagerFactory"
      "doctrine.cli" => "DoctrineModule\Service\CliFactory"
      "DoctrineORMModule\CliConfigurator" => "DoctrineORMModule\Service\CliConfiguratorFactory"
      "Doctrine\ORM\EntityManager" => "DoctrineORMModule\Service\EntityManagerAliasCompatFactory"
      "doctrine.dbal_cmd.runsql" => "DoctrineORMModule\Service\RunSqlCommandFactory"
      "doctrine.dbal_cmd.reserved_words" => "DoctrineORMModule\Service\ReservedWordsCommandFactory"
      "Application\Service\SendMail" => "Application\Service\Factory\SendMailFactory"
      "Application\Service\ElasticaClient" => "Application\Service\Factory\ElasticaClientFactory"
      "Application\Service\ElasticSearch" => "Application\Service\Factory\ElasticSearchFactory"
      "Application\Service\OKLink" => "Application\Service\Factory\OKLinkFactory"
      "Application\Service\Whaleportal" => "Application\Service\Factory\WhaleportalFactory"
      "Application\Service\CoinGlass" => "Application\Service\Factory\CoinGlassFactory"
      "Application\Service\WalletManager" => "Application\Service\Factory\WalletManagerFactory"
      "Application\Service\Nixiesearch" => "Application\Service\Factory\NixiesearchFactory"
      "Application\Service\CoinRemitter" => "Application\Service\Factory\CoinRemitterFactory"
      "Application\Service\CoinLive" => "Application\Service\Factory\CoinLiveFactory"
      "Application\Service\Arkham" => "Application\Service\Factory\ArkhamFactory"
      "Application\Service\Bingx" => "Application\Service\Factory\BingxFactory"
      "Application\Service\Binance" => "Application\Service\Factory\BinanceFactory"
      "Application\Service\Indicator" => "Application\Service\Factory\IndicatorFactory"
      "Application\Service\Sitemap" => "Application\Service\Factory\SitemapFactory"
      "Application\Service\DacVuBot" => "Application\Service\Factory\DacVuBotFactory"
      "Application\BotManager\BotAlert\BotAlert" => "Application\BotManager\Factory\BotAlertFactory"
      "Application\BotManager\BotAdmin\BotAdmin" => "Application\BotManager\Factory\BotAdminFactory"
      "Application\BotManager\BotNews\BotNews" => "Application\BotManager\Factory\BotNewsFactory"
      "Application\BotManager\BotWallet\BotWallet" => "Application\BotManager\Factory\BotWalletFactory"
      "Application\BotManager\BotOnchain\BotOnchain" => "Application\BotManager\Factory\BotOnchainFactory"
      "Application\BotManager\BotMacro\BotMacro" => "Application\BotManager\Factory\BotMacroFactory"
      "Application\BotManager\BotSignal\BotSignal" => "Application\BotManager\Factory\BotSignalFactory"
      "Application\BotManager\BotKols\BotKols" => "Application\BotManager\Factory\BotKolsFactory"
      "Application\BotManager\BotRkt\BotRkt" => "Application\BotManager\Factory\BotRktFactory"
      "Application\BotManager\BotManageRkt\BotManageRkt" => "Application\BotManager\Factory\BotManageRktFactory"
      "Application\BotManager\BotRichkids\BotRichkids" => "Application\BotManager\Factory\BotRichkidsFactory"
      "Application\BotManager\BotExchangeGiftRkt\BotExchangeGiftRkt" => "Application\BotManager\Factory\BotExchangeGiftRktFatory"
      "Application\BotManager\BotAgentMargin\BotAgentMargin" => "Application\BotManager\Factory\BotAgentMarginFatory"
      "Application\BotManager\BotMarginFuture\BotMarginFuture" => "Application\BotManager\Factory\BotMarginFutureFatory"
      "Application\BotManager\BotStudents\BotStudents" => "Application\BotManager\Factory\BotStudentsFactory"
      "Application\BotManager\BotCommnunity\BotCommnunity" => "Application\BotManager\Factory\BotCommnunityFactory"
      "Admin\Service\ImageService" => "Admin\Service\Factory\ImageServiceFactory"
      "Admin\Service\S3Service" => "Admin\Service\Factory\S3ServiceFactory"
      "Laminas\Authentication\AuthenticationService" => "Admin\Service\Factory\AuthenticationServiceFactory"
      "Admin\Service\AuthService" => "Admin\Service\Factory\AuthServiceFactory"
      "Admin\Service\AuthManager" => "Admin\Service\Factory\AuthManagerFactory"
      "Admin\Service\RoleService" => "Admin\Service\Factory\RoleServiceFactory"
      "Admin\Service\CurrentUser" => "Admin\View\Factory\CurrentUserFactory"
      "Admin\Elastic\ECourse" => "Admin\Elastic\Factory\ECourseFactory"
      "Application\Service\PayBinance" => "Application\Service\Factory\PayBinanceFactory"
      "Db\Cache\Redis" => "Application\Cache\RedisFactory"
      "mySqlLogger" => "Application\Log\Factory\SqlLoggerFactory"
      "doctrine.redis.cache" => "Application\Cache\RedisConfig"
      "doctrine.redis.odm.cache" => "Application\Cache\RedisOdmConfig"
      "doctrine.filesystem.cache" => "Application\Cache\FileSystemConfig"
      "doctrine.filesystem.odm.cache" => "Application\Cache\FileSystemOdmConfig"
    ]
    "abstract_factories" => array:8 [
      0 => "Laminas\Log\LoggerAbstractServiceFactory"
      1 => "Laminas\Log\PsrLoggerAbstractAdapterFactory"
      2 => "Laminas\Session\Service\ContainerAbstractServiceFactory"
      3 => "Laminas\Cache\Service\StorageCacheAbstractServiceFactory"
      4 => "Laminas\Form\FormAbstractServiceFactory"
      5 => "Laminas\Db\Adapter\AdapterAbstractServiceFactory"
      "DoctrineModule" => "DoctrineModule\ServiceFactory\AbstractDoctrineServiceFactory"
      6 => "Laminas\Db\Adapter\AdapterAbstractServiceFactory"
    ]
    "invokables" => array:16 [
      "DoctrineModule\Authentication\Storage\Session" => "Laminas\Authentication\Storage\Session"
      "doctrine.orm_cmd.clear_cache_metadata" => "Doctrine\ORM\Tools\Console\Command\ClearCache\MetadataCommand"
      "doctrine.orm_cmd.clear_cache_result" => "Doctrine\ORM\Tools\Console\Command\ClearCache\ResultCommand"
      "doctrine.orm_cmd.clear_cache_query" => "Doctrine\ORM\Tools\Console\Command\ClearCache\QueryCommand"
      "doctrine.orm_cmd.schema_tool_create" => "Doctrine\ORM\Tools\Console\Command\SchemaTool\CreateCommand"
      "doctrine.orm_cmd.schema_tool_update" => "Doctrine\ORM\Tools\Console\Command\SchemaTool\UpdateCommand"
      "doctrine.orm_cmd.schema_tool_drop" => "Doctrine\ORM\Tools\Console\Command\SchemaTool\DropCommand"
      "doctrine.orm_cmd.convert_d1_schema" => "Doctrine\ORM\Tools\Console\Command\ConvertDoctrine1SchemaCommand"
      "doctrine.orm_cmd.generate_entities" => "Doctrine\ORM\Tools\Console\Command\GenerateEntitiesCommand"
      "doctrine.orm_cmd.generate_proxies" => "Doctrine\ORM\Tools\Console\Command\GenerateProxiesCommand"
      "doctrine.orm_cmd.convert_mapping" => "Doctrine\ORM\Tools\Console\Command\ConvertMappingCommand"
      "doctrine.orm_cmd.run_dql" => "Doctrine\ORM\Tools\Console\Command\RunDqlCommand"
      "doctrine.orm_cmd.validate_schema" => "Doctrine\ORM\Tools\Console\Command\ValidateSchemaCommand"
      "doctrine.orm_cmd.info" => "Doctrine\ORM\Tools\Console\Command\InfoCommand"
      "doctrine.orm_cmd.ensure_production_settings" => "Doctrine\ORM\Tools\Console\Command\EnsureProductionSettingsCommand"
      "doctrine.orm_cmd.generate_repositories" => "Doctrine\ORM\Tools\Console\Command\GenerateRepositoriesCommand"
    ]
    "delegators" => array:1 [
      "Laminas\Cache\Storage\AdapterPluginManager" => array:3 [
        0 => "Laminas\Cache\Storage\Adapter\Filesystem\AdapterPluginManagerDelegatorFactory"
        1 => "Laminas\Cache\Storage\Adapter\Memory\AdapterPluginManagerDelegatorFactory"
        2 => "Laminas\Cache\Storage\Adapter\Redis\AdapterPluginManagerDelegatorFactory"
      ]
    ]
  ]
  "view_manager" => array:8 [
    "template_path_stack" => array:6 [
      "laminas-developer-tools" => "/var/www/Rich_Kids/trunk/main/vendor/laminas/laminas-developer-tools/config/../view"
      "layout/layout" => "/var/www/Rich_Kids/trunk/main/module/Application/config/../view_application"
      "layout/kols" => "/var/www/Rich_Kids/trunk/main/module/Application/config/../view_kols"
      "layout/customer" => "/var/www/Rich_Kids/trunk/main/module/Application/config/../view_customer"
      "layout/macro" => "/var/www/Rich_Kids/trunk/main/module/Application/config/../view_macro"
      0 => "/var/www/Rich_Kids/trunk/main/module/Admin/config/../view"
    ]
    "template_map" => array:12 [
      "laminas-developer-tools/toolbar/doctrine-orm-queries" => "/var/www/Rich_Kids/trunk/main/vendor/doctrine/doctrine-orm-module/config/../view/laminas-developer-tools/toolbar/doctrine-orm-queries.phtml"
      "laminas-developer-tools/toolbar/doctrine-orm-mappings" => "/var/www/Rich_Kids/trunk/main/vendor/doctrine/doctrine-orm-module/config/../view/laminas-developer-tools/toolbar/doctrine-orm-mappings.phtml"
      "laminas-developer-tools/toolbar/doctrine-odm" => "/var/www/Rich_Kids/trunk/main/vendor/doctrine/doctrine-mongo-odm-module/config/../view/laminas-developer-tools/toolbar/doctrine-odm.phtml"
      "layout/layout" => "/var/www/Rich_Kids/trunk/main/module/Application/config/../view_application/layout/application.phtml"
      "layout/kols" => "/var/www/Rich_Kids/trunk/main/module/Application/config/../view_kols/layout/masterkols.phtml"
      "layout/iframe" => "/var/www/Rich_Kids/trunk/main/module/Application/config/../view_iframe/layout/iframe.phtml"
      "layout/customer" => "/var/www/Rich_Kids/trunk/main/module/Application/config/../view_customer/layout/customer.phtml"
      "layout/admin" => "/var/www/Rich_Kids/trunk/main/module/Admin/config/../view/layout/admin.phtml"
      "admin/index/index" => "/var/www/Rich_Kids/trunk/main/module/Admin/config/../view/admin/index/index.phtml"
      "error/404" => "/var/www/Rich_Kids/trunk/main/module/Admin/config/../view/error/404.phtml"
      "error/index" => "/var/www/Rich_Kids/trunk/main/module/Admin/config/../view/error/index.phtml"
      "login/admin" => "/var/www/Rich_Kids/trunk/main/module/Admin/config/../view/layout/login.phtml"
    ]
    "doctype" => "HTML5"
    "display_not_found_reason" => true
    "display_exceptions" => true
    "not_found_template" => "error/404"
    "exception_template" => "error/index"
    "strategies" => array:1 [
      0 => "ViewJsonStrategy"
    ]
  ]
  "filters" => array:2 [
    "aliases" => array:14 [
      "alnum" => "Laminas\I18n\Filter\Alnum"
      "Alnum" => "Laminas\I18n\Filter\Alnum"
      "alpha" => "Laminas\I18n\Filter\Alpha"
      "Alpha" => "Laminas\I18n\Filter\Alpha"
      "numberformat" => "Laminas\I18n\Filter\NumberFormat"
      "numberFormat" => "Laminas\I18n\Filter\NumberFormat"
      "NumberFormat" => "Laminas\I18n\Filter\NumberFormat"
      "numberparse" => "Laminas\I18n\Filter\NumberParse"
      "numberParse" => "Laminas\I18n\Filter\NumberParse"
      "NumberParse" => "Laminas\I18n\Filter\NumberParse"
      "Zend\I18n\Filter\Alnum" => "Laminas\I18n\Filter\Alnum"
      "Zend\I18n\Filter\Alpha" => "Laminas\I18n\Filter\Alpha"
      "Zend\I18n\Filter\NumberFormat" => "Laminas\I18n\Filter\NumberFormat"
      "Zend\I18n\Filter\NumberParse" => "Laminas\I18n\Filter\NumberParse"
    ]
    "factories" => array:4 [
      "Laminas\I18n\Filter\Alnum" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\I18n\Filter\Alpha" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\I18n\Filter\NumberFormat" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\I18n\Filter\NumberParse" => "Laminas\ServiceManager\Factory\InvokableFactory"
    ]
  ]
  "validators" => array:2 [
    "aliases" => array:34 [
      "alnum" => "Laminas\I18n\Validator\Alnum"
      "Alnum" => "Laminas\I18n\Validator\Alnum"
      "alpha" => "Laminas\I18n\Validator\Alpha"
      "Alpha" => "Laminas\I18n\Validator\Alpha"
      "datetime" => "Laminas\I18n\Validator\DateTime"
      "dateTime" => "Laminas\I18n\Validator\DateTime"
      "DateTime" => "Laminas\I18n\Validator\DateTime"
      "float" => "Laminas\I18n\Validator\IsFloat"
      "Float" => "Laminas\I18n\Validator\IsFloat"
      "int" => "Laminas\I18n\Validator\IsInt"
      "Int" => "Laminas\I18n\Validator\IsInt"
      "isfloat" => "Laminas\I18n\Validator\IsFloat"
      "isFloat" => "Laminas\I18n\Validator\IsFloat"
      "IsFloat" => "Laminas\I18n\Validator\IsFloat"
      "isint" => "Laminas\I18n\Validator\IsInt"
      "isInt" => "Laminas\I18n\Validator\IsInt"
      "IsInt" => "Laminas\I18n\Validator\IsInt"
      "phonenumber" => "Laminas\I18n\Validator\PhoneNumber"
      "phoneNumber" => "Laminas\I18n\Validator\PhoneNumber"
      "PhoneNumber" => "Laminas\I18n\Validator\PhoneNumber"
      "postcode" => "Laminas\I18n\Validator\PostCode"
      "postCode" => "Laminas\I18n\Validator\PostCode"
      "PostCode" => "Laminas\I18n\Validator\PostCode"
      "Zend\I18n\Validator\Alnum" => "Laminas\I18n\Validator\Alnum"
      "Zend\I18n\Validator\Alpha" => "Laminas\I18n\Validator\Alpha"
      "Zend\I18n\Validator\DateTime" => "Laminas\I18n\Validator\DateTime"
      "Zend\I18n\Validator\IsFloat" => "Laminas\I18n\Validator\IsFloat"
      "Zend\I18n\Validator\IsInt" => "Laminas\I18n\Validator\IsInt"
      "Zend\I18n\Validator\PhoneNumber" => "Laminas\I18n\Validator\PhoneNumber"
      "Zend\I18n\Validator\PostCode" => "Laminas\I18n\Validator\PostCode"
      "csrf" => "Laminas\Session\Validator\Csrf"
      "DoctrineNoObjectExists" => "DoctrineModule\Validator\NoObjectExists"
      "DoctrineObjectExists" => "DoctrineModule\Validator\ObjectExists"
      "DoctrineUniqueObject" => "DoctrineModule\Validator\UniqueObject"
    ]
    "factories" => array:11 [
      "Laminas\I18n\Validator\Alnum" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\I18n\Validator\Alpha" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\I18n\Validator\DateTime" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\I18n\Validator\IsFloat" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\I18n\Validator\IsInt" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\I18n\Validator\PhoneNumber" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\I18n\Validator\PostCode" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Session\Validator\Csrf" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "DoctrineModule\Validator\NoObjectExists" => "DoctrineModule\Validator\Service\NoObjectExistsFactory"
      "DoctrineModule\Validator\ObjectExists" => "DoctrineModule\Validator\Service\ObjectExistsFactory"
      "DoctrineModule\Validator\UniqueObject" => "DoctrineModule\Validator\Service\UniqueObjectFactory"
    ]
  ]
  "view_helpers" => array:3 [
    "aliases" => array:225 [
      "countryCodeDataList" => "Laminas\I18n\View\Helper\CountryCodeDataList"
      "currencyformat" => "Laminas\I18n\View\Helper\CurrencyFormat"
      "currencyFormat" => "Laminas\I18n\View\Helper\CurrencyFormat"
      "CurrencyFormat" => "Laminas\I18n\View\Helper\CurrencyFormat"
      "dateformat" => "Laminas\I18n\View\Helper\DateFormat"
      "dateFormat" => "Laminas\I18n\View\Helper\DateFormat"
      "DateFormat" => "Laminas\I18n\View\Helper\DateFormat"
      "numberformat" => "Laminas\I18n\View\Helper\NumberFormat"
      "numberFormat" => "Laminas\I18n\View\Helper\NumberFormat"
      "NumberFormat" => "Laminas\I18n\View\Helper\NumberFormat"
      "plural" => "Laminas\I18n\View\Helper\Plural"
      "Plural" => "Laminas\I18n\View\Helper\Plural"
      "translate" => "Laminas\I18n\View\Helper\Translate"
      "Translate" => "Laminas\I18n\View\Helper\Translate"
      "translateplural" => "Laminas\I18n\View\Helper\TranslatePlural"
      "translatePlural" => "Laminas\I18n\View\Helper\TranslatePlural"
      "TranslatePlural" => "Laminas\I18n\View\Helper\TranslatePlural"
      "Zend\I18n\View\Helper\CurrencyFormat" => "Laminas\I18n\View\Helper\CurrencyFormat"
      "Zend\I18n\View\Helper\DateFormat" => "Laminas\I18n\View\Helper\DateFormat"
      "Zend\I18n\View\Helper\NumberFormat" => "Laminas\I18n\View\Helper\NumberFormat"
      "Zend\I18n\View\Helper\Plural" => "Laminas\I18n\View\Helper\Plural"
      "Zend\I18n\View\Helper\Translate" => "Laminas\I18n\View\Helper\Translate"
      "Zend\I18n\View\Helper\TranslatePlural" => "Laminas\I18n\View\Helper\TranslatePlural"
      "flashmessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"
      "flashMessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"
      "FlashMessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"
      "Zend\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"
      "zendviewhelperflashmessenger" => "laminasviewhelperflashmessenger"
      "form" => "Laminas\Form\View\Helper\Form"
      "Form" => "Laminas\Form\View\Helper\Form"
      "formbutton" => "Laminas\Form\View\Helper\FormButton"
      "form_button" => "Laminas\Form\View\Helper\FormButton"
      "formButton" => "Laminas\Form\View\Helper\FormButton"
      "FormButton" => "Laminas\Form\View\Helper\FormButton"
      "formcaptcha" => "Laminas\Form\View\Helper\FormCaptcha"
      "form_captcha" => "Laminas\Form\View\Helper\FormCaptcha"
      "formCaptcha" => "Laminas\Form\View\Helper\FormCaptcha"
      "FormCaptcha" => "Laminas\Form\View\Helper\FormCaptcha"
      "captchadumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "captcha_dumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "captcha/dumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "CaptchaDumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "captchaDumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "formcaptchadumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "form_captcha_dumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "formCaptchaDumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "FormCaptchaDumb" => "Laminas\Form\View\Helper\Captcha\Dumb"
      "captchafiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "captcha/figlet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "captcha_figlet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "captchaFiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "CaptchaFiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "formcaptchafiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "form_captcha_figlet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "formCaptchaFiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "FormCaptchaFiglet" => "Laminas\Form\View\Helper\Captcha\Figlet"
      "captchaimage" => "Laminas\Form\View\Helper\Captcha\Image"
      "captcha/image" => "Laminas\Form\View\Helper\Captcha\Image"
      "captcha_image" => "Laminas\Form\View\Helper\Captcha\Image"
      "captchaImage" => "Laminas\Form\View\Helper\Captcha\Image"
      "CaptchaImage" => "Laminas\Form\View\Helper\Captcha\Image"
      "formcaptchaimage" => "Laminas\Form\View\Helper\Captcha\Image"
      "form_captcha_image" => "Laminas\Form\View\Helper\Captcha\Image"
      "formCaptchaImage" => "Laminas\Form\View\Helper\Captcha\Image"
      "FormCaptchaImage" => "Laminas\Form\View\Helper\Captcha\Image"
      "captcharecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "captcha/recaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "captcha_recaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "captchaRecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "CaptchaRecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "formcaptcharecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "form_captcha_recaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "formCaptchaRecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "FormCaptchaRecaptcha" => "Laminas\Form\View\Helper\Captcha\ReCaptcha"
      "formcheckbox" => "Laminas\Form\View\Helper\FormCheckbox"
      "form_checkbox" => "Laminas\Form\View\Helper\FormCheckbox"
      "formCheckbox" => "Laminas\Form\View\Helper\FormCheckbox"
      "FormCheckbox" => "Laminas\Form\View\Helper\FormCheckbox"
      "formcollection" => "Laminas\Form\View\Helper\FormCollection"
      "form_collection" => "Laminas\Form\View\Helper\FormCollection"
      "formCollection" => "Laminas\Form\View\Helper\FormCollection"
      "FormCollection" => "Laminas\Form\View\Helper\FormCollection"
      "formcolor" => "Laminas\Form\View\Helper\FormColor"
      "form_color" => "Laminas\Form\View\Helper\FormColor"
      "formColor" => "Laminas\Form\View\Helper\FormColor"
      "FormColor" => "Laminas\Form\View\Helper\FormColor"
      "formdate" => "Laminas\Form\View\Helper\FormDate"
      "form_date" => "Laminas\Form\View\Helper\FormDate"
      "formDate" => "Laminas\Form\View\Helper\FormDate"
      "FormDate" => "Laminas\Form\View\Helper\FormDate"
      "formdatetime" => "Laminas\Form\View\Helper\FormDateTime"
      "form_date_time" => "Laminas\Form\View\Helper\FormDateTime"
      "formDateTime" => "Laminas\Form\View\Helper\FormDateTime"
      "FormDateTime" => "Laminas\Form\View\Helper\FormDateTime"
      "formdatetimelocal" => "Laminas\Form\View\Helper\FormDateTimeLocal"
      "form_date_time_local" => "Laminas\Form\View\Helper\FormDateTimeLocal"
      "formDateTimeLocal" => "Laminas\Form\View\Helper\FormDateTimeLocal"
      "FormDateTimeLocal" => "Laminas\Form\View\Helper\FormDateTimeLocal"
      "formdatetimeselect" => "Laminas\Form\View\Helper\FormDateTimeSelect"
      "form_date_time_select" => "Laminas\Form\View\Helper\FormDateTimeSelect"
      "formDateTimeSelect" => "Laminas\Form\View\Helper\FormDateTimeSelect"
      "FormDateTimeSelect" => "Laminas\Form\View\Helper\FormDateTimeSelect"
      "formdateselect" => "Laminas\Form\View\Helper\FormDateSelect"
      "form_date_select" => "Laminas\Form\View\Helper\FormDateSelect"
      "formDateSelect" => "Laminas\Form\View\Helper\FormDateSelect"
      "FormDateSelect" => "Laminas\Form\View\Helper\FormDateSelect"
      "form_element" => "Laminas\Form\View\Helper\FormElement"
      "formelement" => "Laminas\Form\View\Helper\FormElement"
      "formElement" => "Laminas\Form\View\Helper\FormElement"
      "FormElement" => "Laminas\Form\View\Helper\FormElement"
      "form_element_errors" => "Laminas\Form\View\Helper\FormElementErrors"
      "formelementerrors" => "Laminas\Form\View\Helper\FormElementErrors"
      "formElementErrors" => "Laminas\Form\View\Helper\FormElementErrors"
      "FormElementErrors" => "Laminas\Form\View\Helper\FormElementErrors"
      "form_email" => "Laminas\Form\View\Helper\FormEmail"
      "formemail" => "Laminas\Form\View\Helper\FormEmail"
      "formEmail" => "Laminas\Form\View\Helper\FormEmail"
      "FormEmail" => "Laminas\Form\View\Helper\FormEmail"
      "form_file" => "Laminas\Form\View\Helper\FormFile"
      "formfile" => "Laminas\Form\View\Helper\FormFile"
      "formFile" => "Laminas\Form\View\Helper\FormFile"
      "FormFile" => "Laminas\Form\View\Helper\FormFile"
      "formfileapcprogress" => "Laminas\Form\View\Helper\File\FormFileApcProgress"
      "form_file_apc_progress" => "Laminas\Form\View\Helper\File\FormFileApcProgress"
      "formFileApcProgress" => "Laminas\Form\View\Helper\File\FormFileApcProgress"
      "FormFileApcProgress" => "Laminas\Form\View\Helper\File\FormFileApcProgress"
      "formfilesessionprogress" => "Laminas\Form\View\Helper\File\FormFileSessionProgress"
      "form_file_session_progress" => "Laminas\Form\View\Helper\File\FormFileSessionProgress"
      "formFileSessionProgress" => "Laminas\Form\View\Helper\File\FormFileSessionProgress"
      "FormFileSessionProgress" => "Laminas\Form\View\Helper\File\FormFileSessionProgress"
      "formfileuploadprogress" => "Laminas\Form\View\Helper\File\FormFileUploadProgress"
      "form_file_upload_progress" => "Laminas\Form\View\Helper\File\FormFileUploadProgress"
      "formFileUploadProgress" => "Laminas\Form\View\Helper\File\FormFileUploadProgress"
      "FormFileUploadProgress" => "Laminas\Form\View\Helper\File\FormFileUploadProgress"
      "formhidden" => "Laminas\Form\View\Helper\FormHidden"
      "form_hidden" => "Laminas\Form\View\Helper\FormHidden"
      "formHidden" => "Laminas\Form\View\Helper\FormHidden"
      "FormHidden" => "Laminas\Form\View\Helper\FormHidden"
      "formimage" => "Laminas\Form\View\Helper\FormImage"
      "form_image" => "Laminas\Form\View\Helper\FormImage"
      "formImage" => "Laminas\Form\View\Helper\FormImage"
      "FormImage" => "Laminas\Form\View\Helper\FormImage"
      "forminput" => "Laminas\Form\View\Helper\FormInput"
      "form_input" => "Laminas\Form\View\Helper\FormInput"
      "formInput" => "Laminas\Form\View\Helper\FormInput"
      "FormInput" => "Laminas\Form\View\Helper\FormInput"
      "formlabel" => "Laminas\Form\View\Helper\FormLabel"
      "form_label" => "Laminas\Form\View\Helper\FormLabel"
      "formLabel" => "Laminas\Form\View\Helper\FormLabel"
      "FormLabel" => "Laminas\Form\View\Helper\FormLabel"
      "formmonth" => "Laminas\Form\View\Helper\FormMonth"
      "form_month" => "Laminas\Form\View\Helper\FormMonth"
      "formMonth" => "Laminas\Form\View\Helper\FormMonth"
      "FormMonth" => "Laminas\Form\View\Helper\FormMonth"
      "formmonthselect" => "Laminas\Form\View\Helper\FormMonthSelect"
      "form_month_select" => "Laminas\Form\View\Helper\FormMonthSelect"
      "formMonthSelect" => "Laminas\Form\View\Helper\FormMonthSelect"
      "FormMonthSelect" => "Laminas\Form\View\Helper\FormMonthSelect"
      "formmulticheckbox" => "Laminas\Form\View\Helper\FormMultiCheckbox"
      "form_multi_checkbox" => "Laminas\Form\View\Helper\FormMultiCheckbox"
      "formMultiCheckbox" => "Laminas\Form\View\Helper\FormMultiCheckbox"
      "FormMultiCheckbox" => "Laminas\Form\View\Helper\FormMultiCheckbox"
      "formnumber" => "Laminas\Form\View\Helper\FormNumber"
      "form_number" => "Laminas\Form\View\Helper\FormNumber"
      "formNumber" => "Laminas\Form\View\Helper\FormNumber"
      "FormNumber" => "Laminas\Form\View\Helper\FormNumber"
      "formpassword" => "Laminas\Form\View\Helper\FormPassword"
      "form_password" => "Laminas\Form\View\Helper\FormPassword"
      "formPassword" => "Laminas\Form\View\Helper\FormPassword"
      "FormPassword" => "Laminas\Form\View\Helper\FormPassword"
      "formradio" => "Laminas\Form\View\Helper\FormRadio"
      "form_radio" => "Laminas\Form\View\Helper\FormRadio"
      "formRadio" => "Laminas\Form\View\Helper\FormRadio"
      "FormRadio" => "Laminas\Form\View\Helper\FormRadio"
      "formrange" => "Laminas\Form\View\Helper\FormRange"
      "form_range" => "Laminas\Form\View\Helper\FormRange"
      "formRange" => "Laminas\Form\View\Helper\FormRange"
      "FormRange" => "Laminas\Form\View\Helper\FormRange"
      "formreset" => "Laminas\Form\View\Helper\FormReset"
      "form_reset" => "Laminas\Form\View\Helper\FormReset"
      "formReset" => "Laminas\Form\View\Helper\FormReset"
      "FormReset" => "Laminas\Form\View\Helper\FormReset"
      "formrow" => "Laminas\Form\View\Helper\FormRow"
      "form_row" => "Laminas\Form\View\Helper\FormRow"
      "formRow" => "Laminas\Form\View\Helper\FormRow"
      "FormRow" => "Laminas\Form\View\Helper\FormRow"
      "formsearch" => "Laminas\Form\View\Helper\FormSearch"
      "form_search" => "Laminas\Form\View\Helper\FormSearch"
      "formSearch" => "Laminas\Form\View\Helper\FormSearch"
      "FormSearch" => "Laminas\Form\View\Helper\FormSearch"
      "formselect" => "Laminas\Form\View\Helper\FormSelect"
      "form_select" => "Laminas\Form\View\Helper\FormSelect"
      "formSelect" => "Laminas\Form\View\Helper\FormSelect"
      "FormSelect" => "Laminas\Form\View\Helper\FormSelect"
      "formsubmit" => "Laminas\Form\View\Helper\FormSubmit"
      "form_submit" => "Laminas\Form\View\Helper\FormSubmit"
      "formSubmit" => "Laminas\Form\View\Helper\FormSubmit"
      "FormSubmit" => "Laminas\Form\View\Helper\FormSubmit"
      "formtel" => "Laminas\Form\View\Helper\FormTel"
      "form_tel" => "Laminas\Form\View\Helper\FormTel"
      "formTel" => "Laminas\Form\View\Helper\FormTel"
      "FormTel" => "Laminas\Form\View\Helper\FormTel"
      "formtext" => "Laminas\Form\View\Helper\FormText"
      "form_text" => "Laminas\Form\View\Helper\FormText"
      "formText" => "Laminas\Form\View\Helper\FormText"
      "FormText" => "Laminas\Form\View\Helper\FormText"
      "formtextarea" => "Laminas\Form\View\Helper\FormTextarea"
      "form_text_area" => "Laminas\Form\View\Helper\FormTextarea"
      "formTextarea" => "Laminas\Form\View\Helper\FormTextarea"
      "formTextArea" => "Laminas\Form\View\Helper\FormTextarea"
      "FormTextArea" => "Laminas\Form\View\Helper\FormTextarea"
      "formtime" => "Laminas\Form\View\Helper\FormTime"
      "form_time" => "Laminas\Form\View\Helper\FormTime"
      "formTime" => "Laminas\Form\View\Helper\FormTime"
      "FormTime" => "Laminas\Form\View\Helper\FormTime"
      "formurl" => "Laminas\Form\View\Helper\FormUrl"
      "form_url" => "Laminas\Form\View\Helper\FormUrl"
      "formUrl" => "Laminas\Form\View\Helper\FormUrl"
      "FormUrl" => "Laminas\Form\View\Helper\FormUrl"
      "formweek" => "Laminas\Form\View\Helper\FormWeek"
      "form_week" => "Laminas\Form\View\Helper\FormWeek"
      "formWeek" => "Laminas\Form\View\Helper\FormWeek"
      "FormWeek" => "Laminas\Form\View\Helper\FormWeek"
      "Sitebar" => "View\Helper\SitebarHelper"
      "CurrentUser" => "Admin\View\Helper\CurrentUser"
    ]
    "factories" => array:58 [
      "Laminas\I18n\View\Helper\CountryCodeDataList" => "Laminas\I18n\View\Helper\Container\CountryCodeDataListFactory"
      "Laminas\I18n\View\Helper\CurrencyFormat" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\I18n\View\Helper\DateFormat" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\I18n\View\Helper\NumberFormat" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\I18n\View\Helper\Plural" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\I18n\View\Helper\Translate" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\I18n\View\Helper\TranslatePlural" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessengerFactory"
      "laminasviewhelperflashmessenger" => "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessengerFactory"
      "Laminas\Form\View\Helper\Form" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormButton" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormCaptcha" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\Captcha\Dumb" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\Captcha\Figlet" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\Captcha\Image" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\Captcha\ReCaptcha" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormCheckbox" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormCollection" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormColor" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDate" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDateTime" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDateTimeLocal" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDateTimeSelect" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormDateSelect" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormElement" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormElementErrors" => "Laminas\Form\View\Helper\Factory\FormElementErrorsFactory"
      "Laminas\Form\View\Helper\FormEmail" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormFile" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\File\FormFileApcProgress" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\File\FormFileSessionProgress" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\File\FormFileUploadProgress" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormHidden" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormImage" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormInput" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormLabel" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormMonth" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormMonthSelect" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormMultiCheckbox" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormNumber" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormPassword" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormRadio" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormRange" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormReset" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormRow" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormSearch" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormSelect" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormSubmit" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormTel" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormText" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormTextarea" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormTime" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormUrl" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Laminas\Form\View\Helper\FormWeek" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "MyGeneral" => "Application\View\Factory\GeneralHelperFactory"
      "MyMenu" => "Application\View\Factory\MenuHelperFactory"
      "View\Helper\SitebarHelper" => "Admin\View\Factory\SitebarHelperFactory"
      "Admin\View\Helper\CurrentUser" => "Admin\View\Factory\CurrentUserFactory"
      "MySetting" => "Admin\View\Factory\SettingFactory"
    ]
    "invokables" => array:1 [
      "translate" => "Laminas\I18n\View\Helper\Translate"
    ]
  ]
  "controller_plugins" => array:2 [
    "aliases" => array:7 [
      "flashmessenger" => "Laminas\Mvc\Plugin\FlashMessenger\FlashMessenger"
      "flashMessenger" => "Laminas\Mvc\Plugin\FlashMessenger\FlashMessenger"
      "FlashMessenger" => "Laminas\Mvc\Plugin\FlashMessenger\FlashMessenger"
      "Laminas\Mvc\Controller\Plugin\FlashMessenger" => "Laminas\Mvc\Plugin\FlashMessenger\FlashMessenger"
      "Zend\Mvc\Controller\Plugin\FlashMessenger" => "Laminas\Mvc\Controller\Plugin\FlashMessenger"
      "Zend\Mvc\Plugin\FlashMessenger\FlashMessenger" => "Laminas\Mvc\Plugin\FlashMessenger\FlashMessenger"
      "MyData" => "Admin\Plugin\MyData"
    ]
    "factories" => array:2 [
      "Laminas\Mvc\Plugin\FlashMessenger\FlashMessenger" => "Laminas\ServiceManager\Factory\InvokableFactory"
      "Admin\Plugin\MyData" => "Laminas\ServiceManager\Factory\InvokableFactory"
    ]
  ]
  "laminas-cli" => array:1 [
    "commands" => array:1 [
      "laminas-cache:deprecation:check-storage-factory-config" => "Laminas\Cache\Command\DeprecatedStorageFactoryConfigurationCheckCommand"
    ]
  ]
  "input_filters" => array:1 [
    "abstract_factories" => array:1 [
      0 => "Laminas\InputFilter\InputFilterAbstractServiceFactory"
    ]
  ]
  "route_manager" => []
  "router" => array:1 [
    "routes" => array:61 [
      "doctrine_orm_module_yuml" => array:2 [
        "type" => "literal"
        "options" => array:2 [
          "route" => "/ocra_service_manager_yuml"
          "defaults" => array:2 [
            "controller" => "DoctrineORMModule\Yuml\YumlController"
            "action" => "index"
          ]
        ]
      ]
      "app.feel" => array:2 [
        "type" => "Segment"
        "options" => array:2 [
          "route" => "/tin-nhanh[/:params]"
          "defaults" => array:2 [
            "controller" => "App.CryptoController"
            "action" => "feel"
          ]
        ]
      ]
      "app.crypto" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/crypto"
          "defaults" => array:2 [
            "controller" => "App.CryptoController"
            "action" => "index"
          ]
        ]
        "may_terminate" => true
        "child_routes" => array:3 [
          "bot" => array:2 [
            "type" => "Segment"
            "options" => array:2 [
              "route" => "/bot[/:params]"
              "defaults" => array:2 [ …2]
            ]
          ]
          "longshort" => array:2 [
            "type" => "Segment"
            "options" => array:2 [
              "route" => "/long-short[/:params]"
              "defaults" => array:2 [ …2]
            ]
          ]
          "funding" => array:2 [
            "type" => "Segment"
            "options" => array:2 [
              "route" => "/funding[/:params]"
              "defaults" => array:2 [ …2]
            ]
          ]
        ]
      ]
      "crypto.arkhamintelligence" => array:2 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/arkhamintelligence/alerts"
          "defaults" => array:2 [
            "controller" => "App.CryptoController"
            "action" => "alerts"
          ]
        ]
      ]
      "app.identify" => array:4 [
        "type" => "Laminas\Router\Http\Literal"
        "options" => array:2 [
          "route" => "/identify"
          "defaults" => array:2 [
            "controller" => "Application.Appkols.IdentifyController"
            "action" => "index"
          ]
        ]
        "may_terminate" => true
        "child_routes" => array:1 [
          "index" => array:2 [
            "type" => "Laminas\Router\Http\Literal"
            "options" => array:2 [
              "route" => "/index"
              "defaults" => array:2 [ …2]
            ]
          ]
        ]
      ]
      "app.kols" => array:4 [
        "type" => "Laminas\Router\Http\Literal"
        "options" => array:2 [
          "route" => "/course"
          "defaults" => array:2 [
            "controller" => "Application.Appkols.CourseController"
            "action" => "index"
          ]
        ]
        "may_terminate" => true
        "child_routes" => array:8 [
          "review" => array:2 [
            "type" => "Laminas\Router\Http\Literal"
            "options" => array:2 [
              "route" => "/my-review"
              "defaults" => array:2 [ …2]
            ]
          ]
          "cate" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:2 [
              "route" => "/cate[/:slug]"
              "defaults" => array:2 [ …2]
            ]
          ]
          "search" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:2 [
              "route" => "/search[/:slug]"
              "defaults" => array:2 [ …2]
            ]
          ]
          "postsearch" => array:2 [
            "type" => "Laminas\Router\Http\Literal"
            "options" => array:2 [
              "route" => "/post-search"
              "defaults" => array:2 [ …2]
            ]
          ]
          "detail" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:2 [
              "route" => "/detail[/:slug]"
              "defaults" => array:2 [ …2]
            ]
          ]
          "cart" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:2 [
              "route" => "/cart[/:slug]"
              "defaults" => array:2 [ …2]
            ]
          ]
          "study" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:2 [
              "route" => "/lesson/[:cate[/:slug]]"
              "defaults" => array:2 [ …2]
            ]
          ]
          "kols" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:3 [
              "route" => "/kol/[:id]"
              "constraints" => array:1 [ …1]
              "defaults" => array:2 [ …2]
            ]
          ]
        ]
      ]
      "app.news" => array:4 [
        "type" => "Laminas\Router\Http\Literal"
        "options" => array:2 [
          "route" => "/news"
          "defaults" => array:2 [
            "controller" => "Application.Appkols.NewsController"
            "action" => "index"
          ]
        ]
        "may_terminate" => true
        "child_routes" => array:3 [
          "cate" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:2 [
              "route" => "/cate[/:slug]"
              "defaults" => array:2 [ …2]
            ]
          ]
          "detail" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:2 [
              "route" => "/detail[/:slug]"
              "defaults" => array:2 [ …2]
            ]
          ]
          "comment" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:2 [
              "route" => "/comment/[:method[/:id]]"
              "defaults" => array:2 [ …2]
            ]
          ]
        ]
      ]
      "app.kols.user" => array:4 [
        "type" => "Laminas\Router\Http\Literal"
        "options" => array:2 [
          "route" => "/customer"
          "defaults" => array:2 [
            "controller" => "Application.Appkols.StudentController"
            "action" => "index"
          ]
        ]
        "may_terminate" => true
        "child_routes" => array:11 [
          "user_telegram" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:2 [
              "route" => "/telegram[/:method]"
              "defaults" => array:2 [ …2]
            ]
          ]
          "user_manager" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:2 [
              "route" => "/manager[/:method]"
              "defaults" => array:2 [ …2]
            ]
          ]
          "logout" => array:2 [
            "type" => "Laminas\Router\Http\Literal"
            "options" => array:2 [
              "route" => "/logout"
              "defaults" => array:2 [ …2]
            ]
          ]
          "user_infouser" => array:2 [
            "type" => "Laminas\Router\Http\Literal"
            "options" => array:2 [
              "route" => "/info"
              "defaults" => array:2 [ …2]
            ]
          ]
          "infotelegram" => array:2 [
            "type" => "Laminas\Router\Http\Literal"
            "options" => array:2 [
              "route" => "/infotelegram"
              "defaults" => array:2 [ …2]
            ]
          ]
          "user_changepassword" => array:2 [
            "type" => "Laminas\Router\Http\Literal"
            "options" => array:2 [
              "route" => "/changepassword"
              "defaults" => array:2 [ …2]
            ]
          ]
          "user_enrol" => array:2 [
            "type" => "Laminas\Router\Http\Literal"
            "options" => array:2 [
              "route" => "/enrol"
              "defaults" => array:2 [ …2]
            ]
          ]
          "user_wishlist" => array:2 [
            "type" => "Laminas\Router\Http\Literal"
            "options" => array:2 [
              "route" => "/wishlist"
              "defaults" => array:2 [ …2]
            ]
          ]
          "user_payment" => array:2 [
            "type" => "Laminas\Router\Http\Literal"
            "options" => array:2 [
              "route" => "/payment"
              "defaults" => array:2 [ …2]
            ]
          ]
          "user_comment" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:2 [
              "route" => "/comment[/:method[/:id]]"
              "defaults" => array:2 [ …2]
            ]
          ]
          "user_history" => array:2 [
            "type" => "Laminas\Router\Http\Literal"
            "options" => array:2 [
              "route" => "/history"
              "defaults" => array:2 [ …2]
            ]
          ]
        ]
      ]
      "app.kols.guest" => array:4 [
        "type" => "Laminas\Router\Http\Literal"
        "options" => array:1 [
          "route" => "/guest"
        ]
        "may_terminate" => true
        "child_routes" => array:6 [
          "signup" => array:2 [
            "type" => "Laminas\Router\Http\Literal"
            "options" => array:2 [
              "route" => "/signup"
              "defaults" => array:2 [ …2]
            ]
          ]
          "signin" => array:2 [
            "type" => "Laminas\Router\Http\Literal"
            "options" => array:2 [
              "route" => "/signin"
              "defaults" => array:2 [ …2]
            ]
          ]
          "forgetpassword" => array:2 [
            "type" => "Laminas\Router\Http\Literal"
            "options" => array:2 [
              "route" => "/forgetpassword"
              "defaults" => array:2 [ …2]
            ]
          ]
          "socialnetwork" => array:2 [
            "type" => "Laminas\Router\Http\Literal"
            "options" => array:2 [
              "route" => "/socialnetwork"
              "defaults" => array:2 [ …2]
            ]
          ]
          "logintelegram" => array:2 [
            "type" => "Laminas\Router\Http\Literal"
            "options" => array:2 [
              "route" => "/login_telegram"
              "defaults" => array:2 [ …2]
            ]
          ]
          "confirm_user" => array:2 [
            "type" => "Laminas\Router\Http\Literal"
            "options" => array:2 [
              "route" => "/confirm_user"
              "defaults" => array:2 [ …2]
            ]
          ]
        ]
      ]
      "app.kols.manager" => array:4 [
        "type" => "Laminas\Router\Http\Literal"
        "options" => array:1 [
          "route" => "/manager"
        ]
        "may_terminate" => true
        "child_routes" => array:7 [
          "member" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:2 [
              "route" => "/member"
              "defaults" => array:2 [ …2]
            ]
          ]
          "course" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:2 [
              "route" => "/course[/:method[/:id]]"
              "defaults" => array:2 [ …2]
            ]
          ]
          "news" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:2 [
              "route" => "/news[/:method[/:id]]"
              "defaults" => array:2 [ …2]
            ]
          ]
          "payment" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:2 [
              "route" => "/payment[/:method[/:id]]"
              "defaults" => array:2 [ …2]
            ]
          ]
          "report" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:2 [
              "route" => "/report[/:method[/:id]]"
              "defaults" => array:2 [ …2]
            ]
          ]
          "market" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:2 [
              "route" => "/market[/:method[/:id]]"
              "defaults" => array:2 [ …2]
            ]
          ]
          "setting" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:2 [
              "route" => "/setting[/:method[/:id]]"
              "defaults" => array:2 [ …2]
            ]
          ]
        ]
      ]
      "application.home" => array:2 [
        "type" => "Laminas\Router\Http\Literal"
        "options" => array:2 [
          "route" => "/"
          "defaults" => array:2 [
            "controller" => "Application.HomeController"
            "action" => "index"
          ]
        ]
      ]
      "application.managerkt" => array:4 [
        "type" => "Laminas\Router\Http\Literal"
        "options" => array:2 [
          "route" => "/manage-app"
          "defaults" => array:2 [
            "controller" => "Application.ManagerktController"
            "action" => "index"
          ]
        ]
        "may_terminate" => true
        "child_routes" => array:3 [
          "application.managerkt.login" => array:2 [
            "type" => "Laminas\Router\Http\Literal"
            "options" => array:2 [
              "route" => "/login"
              "defaults" => array:2 [ …2]
            ]
          ]
          "application.managerkt.index" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:2 [
              "route" => "/page[/:method]"
              "defaults" => array:2 [ …2]
            ]
          ]
          "application.managerkt.apijson" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:2 [
              "route" => "/api-json[/:method[/:actions[/:param]]]"
              "defaults" => array:2 [ …2]
            ]
          ]
        ]
      ]
      "application.agentmargin" => array:4 [
        "type" => "Laminas\Router\Http\Literal"
        "options" => array:2 [
          "route" => "/miniapp-agent-margin"
          "defaults" => array:2 [
            "controller" => "Application.AgentMarginController"
            "action" => "index"
          ]
        ]
        "may_terminate" => true
        "child_routes" => array:3 [
          "application.agentmargin.login" => array:2 [
            "type" => "Laminas\Router\Http\Literal"
            "options" => array:2 [
              "route" => "/login"
              "defaults" => array:2 [ …2]
            ]
          ]
          "application.agentmargin.index" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:2 [
              "route" => "/page[/:method]"
              "defaults" => array:2 [ …2]
            ]
          ]
          "application.agentmargin.apijson" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:2 [
              "route" => "/api-json[/:method]"
              "defaults" => array:2 [ …2]
            ]
          ]
        ]
      ]
      "application.students" => array:4 [
        "type" => "Laminas\Router\Http\Literal"
        "options" => array:2 [
          "route" => "/miniapp-students"
          "defaults" => array:2 [
            "controller" => "Application.StudentsController"
            "action" => "index"
          ]
        ]
        "may_terminate" => true
        "child_routes" => array:3 [
          "application.students.login" => array:2 [
            "type" => "Laminas\Router\Http\Literal"
            "options" => array:2 [
              "route" => "/login"
              "defaults" => array:2 [ …2]
            ]
          ]
          "application.students.index" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:2 [
              "route" => "/page[/:method]"
              "defaults" => array:2 [ …2]
            ]
          ]
          "application.students.apijson" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:2 [
              "route" => "/api-json[/:method]"
              "defaults" => array:2 [ …2]
            ]
          ]
        ]
      ]
      "application.community" => array:4 [
        "type" => "Laminas\Router\Http\Literal"
        "options" => array:2 [
          "route" => "/miniapp-community"
          "defaults" => array:2 [
            "controller" => "Application.CommunityController"
            "action" => "index"
          ]
        ]
        "may_terminate" => true
        "child_routes" => array:3 [
          "application.community.login" => array:2 [
            "type" => "Laminas\Router\Http\Literal"
            "options" => array:2 [
              "route" => "/login"
              "defaults" => array:2 [ …2]
            ]
          ]
          "application.community.index" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:2 [
              "route" => "/page[/:method]"
              "defaults" => array:2 [ …2]
            ]
          ]
          "application.community.apijson" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:2 [
              "route" => "/api-json[/:method]"
              "defaults" => array:2 [ …2]
            ]
          ]
        ]
      ]
      "application.phongthuy" => array:2 [
        "type" => "Laminas\Router\Http\Literal"
        "options" => array:2 [
          "route" => "/phong-thuy"
          "defaults" => array:2 [
            "controller" => "Application.HomeController"
            "action" => "phongthuy"
          ]
        ]
      ]
      "application.chiemtinh" => array:2 [
        "type" => "Laminas\Router\Http\Literal"
        "options" => array:2 [
          "route" => "/chiem-tinh"
          "defaults" => array:2 [
            "controller" => "Application.HomeController"
            "action" => "chiemtinh"
          ]
        ]
      ]
      "application.exchangegifts" => array:4 [
        "type" => "Laminas\Router\Http\Literal"
        "options" => array:2 [
          "route" => "/doi-qua"
          "defaults" => array:2 [
            "controller" => "Application.ExchangegiftController"
            "action" => "exchangegifts"
          ]
        ]
        "may_terminate" => true
        "child_routes" => array:1 [
          "application.exchangegifts.d" => array:2 [
            "type" => "Laminas\Router\Http\Literal"
            "options" => array:2 [
              "route" => "/lich-su-don-hang"
              "defaults" => array:2 [ …2]
            ]
          ]
        ]
      ]
      "application.exchangegifts_dashboard" => array:4 [
        "type" => "Laminas\Router\Http\Literal"
        "options" => array:2 [
          "route" => "/dashboard-rkt"
          "defaults" => array:2 [
            "controller" => "Application.ExchangegiftController"
            "action" => "exchangegiftsdashboard"
          ]
        ]
        "may_terminate" => true
        "child_routes" => array:1 [
          "application.competition.detail" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:2 [
              "route" => "/[:method]"
              "defaults" => array:2 [ …2]
            ]
          ]
        ]
      ]
      "application.competition" => array:4 [
        "type" => "Laminas\Router\Http\Literal"
        "options" => array:2 [
          "route" => "/thi-giai"
          "defaults" => array:2 [
            "controller" => "Application.HomeController"
            "action" => "competition"
          ]
        ]
        "may_terminate" => true
        "child_routes" => array:1 [
          "application.competition.detail" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:2 [
              "route" => "/[:method][/:params]"
              "defaults" => array:2 [ …2]
            ]
          ]
        ]
      ]
      "application.sitemap" => array:2 [
        "type" => "Laminas\Router\Http\Literal"
        "options" => array:2 [
          "route" => "/sitemap.xml"
          "defaults" => array:2 [
            "controller" => "Application.HomeController"
            "action" => "sitemap"
          ]
        ]
      ]
      "application.sitemapdetail" => array:2 [
        "type" => "Laminas\Router\Http\Segment"
        "options" => array:2 [
          "route" => "/sitemap[/:method[/:param]]"
          "defaults" => array:2 [
            "controller" => "Application.HomeController"
            "action" => "sitemapdetail"
          ]
        ]
      ]
      "application.appnews" => array:2 [
        "type" => "Laminas\Router\Http\Segment"
        "options" => array:2 [
          "route" => "/app-news[/:method[/:param]]"
          "defaults" => array:2 [
            "controller" => "Application.HomeController"
            "action" => "news"
          ]
        ]
      ]
      "application.page" => array:2 [
        "type" => "Laminas\Router\Http\Segment"
        "options" => array:2 [
          "route" => "/page[/:methods[/:param]]"
          "defaults" => array:2 [
            "controller" => "Application.HomeController"
            "action" => "page"
          ]
        ]
      ]
      "app.onchain" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/onchain"
          "defaults" => array:2 [
            "controller" => "App.OnchainController"
            "action" => "index"
          ]
        ]
        "may_terminate" => true
        "child_routes" => array:4 [
          "data" => array:2 [
            "type" => "Segment"
            "options" => array:2 [
              "route" => "[/:parent[/:child[/:product]]]"
              "defaults" => array:2 [ …2]
            ]
          ]
          "crontab" => array:2 [
            "type" => "Literal"
            "options" => array:2 [
              "route" => "/crontab"
              "defaults" => array:2 [ …2]
            ]
          ]
          "bookmap" => array:2 [
            "type" => "Literal"
            "options" => array:2 [
              "route" => "/bookmap"
              "defaults" => array:2 [ …2]
            ]
          ]
          "username" => array:2 [
            "type" => "Literal"
            "options" => array:2 [
              "route" => "/username"
              "defaults" => array:2 [ …2]
            ]
          ]
        ]
      ]
      "crontab" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/crontab"
          "defaults" => array:2 [
            "controller" => "App.CrontabController"
            "action" => "index"
          ]
        ]
        "may_terminate" => true
        "child_routes" => array:10 [
          "feel" => array:2 [
            "type" => "Literal"
            "options" => array:2 [
              "route" => "/feel"
              "defaults" => array:2 [ …2]
            ]
          ]
          "onchain" => array:2 [
            "type" => "Literal"
            "options" => array:2 [
              "route" => "/onchain"
              "defaults" => array:2 [ …2]
            ]
          ]
          "fireminus" => array:2 [
            "type" => "Literal"
            "options" => array:2 [
              "route" => "/fireminus"
              "defaults" => array:2 [ …2]
            ]
          ]
          "tensecond" => array:2 [
            "type" => "Literal"
            "options" => array:2 [
              "route" => "/tensecond"
              "defaults" => array:2 [ …2]
            ]
          ]
          "importlisttoken" => array:2 [
            "type" => "Literal"
            "options" => array:2 [
              "route" => "/import-list-token"
              "defaults" => array:2 [ …2]
            ]
          ]
          "clearallcache" => array:2 [
            "type" => "Literal"
            "options" => array:2 [
              "route" => "/clear-all-cache"
              "defaults" => array:2 [ …2]
            ]
          ]
          "calendar" => array:2 [
            "type" => "Literal"
            "options" => array:2 [
              "route" => "/calendar"
              "defaults" => array:2 [ …2]
            ]
          ]
          "oneday" => array:2 [
            "type" => "Literal"
            "options" => array:2 [
              "route" => "/oneday"
              "defaults" => array:2 [ …2]
            ]
          ]
          "onehour" => array:2 [
            "type" => "Literal"
            "options" => array:2 [
              "route" => "/onehour"
              "defaults" => array:2 [ …2]
            ]
          ]
          "calendarevent" => array:2 [
            "type" => "Literal"
            "options" => array:2 [
              "route" => "/calendarevent"
              "defaults" => array:2 [ …2]
            ]
          ]
        ]
      ]
      "websocket" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/websocket"
          "defaults" => array:2 [
            "controller" => "App.WebsocketController"
            "action" => "index"
          ]
        ]
        "may_terminate" => true
        "child_routes" => array:3 [
          "websocket.feel" => array:2 [
            "type" => "Literal"
            "options" => array:2 [
              "route" => "/feel"
              "defaults" => array:2 [ …2]
            ]
          ]
          "init" => array:2 [
            "type" => "Segment"
            "options" => array:2 [
              "route" => "/server[/:method[/:param]]"
              "defaults" => array:2 [ …2]
            ]
          ]
          "whalealert" => array:2 [
            "type" => "Literal"
            "options" => array:2 [
              "route" => "/whalealert"
              "defaults" => array:2 [ …2]
            ]
          ]
        ]
      ]
      "bingx" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/bingx"
          "defaults" => array:2 [
            "controller" => "App.BingxController"
            "action" => "index"
          ]
        ]
        "may_terminate" => true
        "child_routes" => array:1 [
          "index" => array:2 [
            "type" => "Segment"
            "options" => array:2 [
              "route" => "/index[/:cate[/:product]]"
              "defaults" => array:2 [ …2]
            ]
          ]
        ]
      ]
      "app.macro" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/macro"
          "defaults" => array:2 [
            "controller" => "App.MacroController"
            "action" => "index"
          ]
        ]
        "may_terminate" => true
        "child_routes" => array:1 [
          "page_macro" => array:2 [
            "type" => "Segment"
            "options" => array:2 [
              "route" => "/[:method][/:params]"
              "defaults" => array:2 [ …2]
            ]
          ]
        ]
      ]
      "application.upgrade" => array:2 [
        "type" => "Laminas\Router\Http\Literal"
        "options" => array:2 [
          "route" => "/upgrade-user"
          "defaults" => array:2 [
            "controller" => "Application.CartController"
            "action" => "upgrade"
          ]
        ]
      ]
      "cart.binancewebhook" => array:2 [
        "type" => "Laminas\Router\Http\Literal"
        "options" => array:2 [
          "route" => "/binancePayWebhookCallbackApi.php"
          "defaults" => array:2 [
            "controller" => "Application.CartController"
            "action" => "binancewebhook"
          ]
        ]
      ]
      "cart.payment" => array:2 [
        "type" => "Laminas\Router\Http\Literal"
        "options" => array:2 [
          "route" => "/payment-user"
          "defaults" => array:2 [
            "controller" => "Application.CartController"
            "action" => "payment"
          ]
        ]
      ]
      "cart.notify" => array:2 [
        "type" => "Laminas\Router\Http\Literal"
        "options" => array:2 [
          "route" => "/payment-notify"
          "defaults" => array:2 [
            "controller" => "Application.CartController"
            "action" => "notify"
          ]
        ]
      ]
      "cart.success" => array:2 [
        "type" => "Laminas\Router\Http\Literal"
        "options" => array:2 [
          "route" => "/payment-success"
          "defaults" => array:2 [
            "controller" => "Application.CartController"
            "action" => "success"
          ]
        ]
      ]
      "admin" => array:4 [
        "type" => "Laminas\Router\Http\Literal"
        "options" => array:2 [
          "route" => "/admin"
          "defaults" => array:2 [
            "controller" => "Controller\IndexController"
            "action" => "index"
          ]
        ]
        "may_terminate" => true
        "child_routes" => array:2 [
          "default" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:3 [
              "route" => "/[:folder[/:controller[/:action[/:id]]]][/][:parent]"
              "constraints" => array:1 [ …1]
              "defaults" => []
            ]
          ]
          "paginator" => array:2 [
            "type" => "Laminas\Router\Http\Segment"
            "options" => array:3 [
              "route" => "/[:folder[/:controller[/:action[/:id]]]]/page[/:page][/][:id][/]"
              "constraints" => array:2 [ …2]
              "defaults" => []
            ]
          ]
        ]
      ]
      "admin.login" => array:2 [
        "type" => "Laminas\Router\Http\Literal"
        "options" => array:2 [
          "route" => "/admin/login"
          "defaults" => array:2 [
            "controller" => "Admin.AuthController"
            "action" => "login"
          ]
        ]
      ]
      "admin.logout" => array:2 [
        "type" => "Laminas\Router\Http\Literal"
        "options" => array:2 [
          "route" => "/admin/logout"
          "defaults" => array:2 [
            "controller" => "Admin.AuthController"
            "action" => "logout"
          ]
        ]
      ]
      "api.onchain" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/webservice/onchain"
          "defaults" => []
        ]
        "may_terminate" => true
        "child_routes" => array:1 [
          "main" => array:2 [
            "type" => "Segment"
            "options" => array:2 [
              "route" => "/[:parent][/:child[/:product[/:param]]]"
              "defaults" => array:2 [ …2]
            ]
          ]
        ]
      ]
      "api.exchangegift" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/webservice/exchangegift"
          "defaults" => []
        ]
        "may_terminate" => true
        "child_routes" => array:1 [
          "main" => array:2 [
            "type" => "Segment"
            "options" => array:2 [
              "route" => "/[:method][/:param[/:id]]"
              "defaults" => array:2 [ …2]
            ]
          ]
        ]
      ]
      "api.exchangegiftdashboard" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/webservice/exchangegiftdashboard"
          "defaults" => []
        ]
        "may_terminate" => true
        "child_routes" => array:1 [
          "main" => array:2 [
            "type" => "Segment"
            "options" => array:2 [
              "route" => "/[:method][/:param[/:id]]"
              "defaults" => array:2 [ …2]
            ]
          ]
        ]
      ]
      "api.macro" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/webservice/macro"
          "defaults" => []
        ]
        "may_terminate" => true
        "child_routes" => array:1 [
          "api.mainmacro" => array:2 [
            "type" => "Segment"
            "options" => array:2 [
              "route" => "/[:parent][/:child[/:product[/:param]]]"
              "defaults" => array:2 [ …2]
            ]
          ]
        ]
      ]
      "api.kols" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/webservice/kols"
          "defaults" => []
        ]
        "may_terminate" => true
        "child_routes" => array:7 [
          "api.kols.telegram" => array:2 [
            "type" => "Segment"
            "options" => array:2 [
              "route" => "/telegram[/:method[/:param]]"
              "defaults" => array:2 [ …2]
            ]
          ]
          "api.kols.course" => array:2 [
            "type" => "Segment"
            "options" => array:2 [
              "route" => "/course[/:method[/:param]]"
              "defaults" => array:2 [ …2]
            ]
          ]
          "api.kols.wishlist" => array:2 [
            "type" => "Segment"
            "options" => array:2 [ …2]
          ]
          "api.kols.index" => array:2 [
            "type" => "Segment"
            "options" => array:2 [ …2]
          ]
          "cart" => array:2 [
            "type" => "Segment"
            "options" => array:2 [ …2]
          ]
          "student" => array:2 [
            "type" => "Segment"
            "options" => array:2 [ …2]
          ]
          "comment" => array:2 [
            "type" => "Segment"
            "options" => array:2 [ …2]
          ]
        ]
      ]
      "api.crypto" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/webservice/crypto"
          "defaults" => []
        ]
        "may_terminate" => true
        "child_routes" => array:1 [
          "main" => array:2 [
            "type" => "Segment"
            "options" => array:2 [ …2]
          ]
        ]
      ]
      "api.feelmain" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/webservice/feel"
          "defaults" => []
        ]
        "may_terminate" => true
        "child_routes" => array:1 [
          "main" => array:2 [
            "type" => "Segment"
            "options" => array:2 [ …2]
          ]
        ]
      ]
      "api.competition" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/webservice/competition"
          "defaults" => []
        ]
        "may_terminate" => true
        "child_routes" => array:1 [
          "main" => array:2 [
            "type" => "Segment"
            "options" => array:2 [ …2]
          ]
        ]
      ]
      "api.apietf" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/webservice/apietf"
          "defaults" => []
        ]
        "may_terminate" => true
        "child_routes" => array:2 [
          "main" => array:2 [
            "type" => "Literal"
            "options" => array:2 [ …2]
          ]
          "detailetf" => array:2 [
            "type" => "Literal"
            "options" => array:2 [ …2]
          ]
        ]
      ]
      "api.economic" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/webservice/economic"
          "defaults" => []
        ]
        "may_terminate" => true
        "child_routes" => array:1 [
          "main" => array:2 [
            "type" => "Segment"
            "options" => array:2 [ …2]
          ]
        ]
      ]
      "api.gettoken" => array:2 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/webservice/token/refresh"
          "defaults" => array:2 [
            "controller" => "Restful\Controller\General\AdsController"
            "action" => "gettoken"
          ]
        ]
      ]
      "api.ads" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/webservice/ads"
          "defaults" => []
        ]
        "may_terminate" => true
        "child_routes" => array:1 [
          "ads" => array:2 [
            "type" => "Segment"
            "options" => array:2 [ …2]
          ]
        ]
      ]
      "api.popup" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/webservice/popup"
          "defaults" => []
        ]
        "may_terminate" => true
        "child_routes" => array:1 [
          "ads" => array:2 [
            "type" => "Segment"
            "options" => array:2 [ …2]
          ]
        ]
      ]
      "api.chiemtinh" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/webservice/liquidity"
          "defaults" => []
        ]
        "may_terminate" => true
        "child_routes" => array:1 [
          "ads" => array:2 [
            "type" => "Segment"
            "options" => array:2 [ …2]
          ]
        ]
      ]
      "api.payment" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/webservice/detailpayment"
          "defaults" => []
        ]
        "may_terminate" => true
        "child_routes" => array:1 [
          "index" => array:2 [
            "type" => "Segment"
            "options" => array:2 [ …2]
          ]
        ]
      ]
      "api.telegram" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/webservice/telegram"
          "defaults" => []
        ]
        "may_terminate" => true
        "child_routes" => array:1 [
          "ads" => array:2 [
            "type" => "Segment"
            "options" => array:2 [ …2]
          ]
        ]
      ]
      "api.notification" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/webservice/notification"
          "defaults" => []
        ]
        "may_terminate" => true
        "child_routes" => array:1 [
          "ads" => array:2 [
            "type" => "Segment"
            "options" => array:2 [ …2]
          ]
        ]
      ]
      "api.coinmarket" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/webservice/coinmarket"
          "defaults" => []
        ]
        "may_terminate" => true
        "child_routes" => array:1 [
          "ads" => array:2 [
            "type" => "Segment"
            "options" => array:2 [ …2]
          ]
        ]
      ]
      "api.systemnews" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/webservice/apisysnews"
          "defaults" => []
        ]
        "may_terminate" => true
        "child_routes" => array:1 [
          "general" => array:2 [
            "type" => "Segment"
            "options" => array:2 [ …2]
          ]
        ]
      ]
      "api.gpt" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/webservice/apichat"
          "defaults" => []
        ]
        "may_terminate" => true
        "child_routes" => array:1 [
          "chatgpt" => array:2 [
            "type" => "Segment"
            "options" => array:2 [ …2]
          ]
        ]
      ]
      "api.news" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/webservice/apinews"
          "defaults" => []
        ]
        "may_terminate" => true
        "child_routes" => array:10 [
          "general" => array:2 [
            "type" => "Segment"
            "options" => array:2 [ …2]
          ]
          "api.news.allhome" => array:2 [
            "type" => "Literal"
            "options" => array:2 [ …2]
          ]
          "api.news.home" => array:2 [
            "type" => "Segment"
            "options" => array:3 [ …3]
          ]
          "api.news.cate" => array:2 [
            "type" => "Literal"
            "options" => array:2 [ …2]
          ]
          "api.news.feel" => array:2 [
            "type" => "Literal"
            "options" => array:2 [ …2]
          ]
          "api.news.socket" => array:2 [
            "type" => "Literal"
            "options" => array:2 [ …2]
          ]
          "api.news.limit" => array:2 [
            "type" => "Literal"
            "options" => array:2 [ …2]
          ]
          "api.news.limitpagi" => array:2 [
            "type" => "Literal"
            "options" => array:2 [ …2]
          ]
          "api.news.feelpagi" => array:2 [
            "type" => "Literal"
            "options" => array:2 [ …2]
          ]
          "api.news.pagi" => array:2 [
            "type" => "Literal"
            "options" => array:2 [ …2]
          ]
        ]
      ]
      "api.user" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/webservice/user"
          "defaults" => []
        ]
        "may_terminate" => true
        "child_routes" => array:4 [
          "api.user.username" => array:2 [
            "type" => "Literal"
            "options" => array:2 [ …2]
          ]
          "api.user.checkemail" => array:2 [
            "type" => "Literal"
            "options" => array:2 [ …2]
          ]
          "api.user.video" => array:2 [
            "type" => "Literal"
            "options" => array:2 [ …2]
          ]
          "api.user.index" => array:2 [
            "type" => "Segment"
            "options" => array:2 [ …2]
          ]
        ]
      ]
      "api.cate" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/webservice/cate"
          "defaults" => []
        ]
        "may_terminate" => true
        "child_routes" => array:1 [
          "api.cate.getall" => array:2 [
            "type" => "Literal"
            "options" => array:2 [ …2]
          ]
        ]
      ]
      "api.reviewcourse" => array:4 [
        "type" => "Literal"
        "options" => array:2 [
          "route" => "/webservice/reviewcourse"
          "defaults" => []
        ]
        "may_terminate" => true
        "child_routes" => array:1 [
          "api.reviewcourse.index" => array:2 [
            "type" => "Segment"
            "options" => array:2 [ …2]
          ]
        ]
      ]
    ]
  ]
  "caches" => array:8 [
    "doctrinemodule.cache.apcu" => array:2 [
      "adapter" => "apcu"
      "options" => array:1 [
        "namespace" => "DoctrineModule"
      ]
    ]
    "doctrinemodule.cache.array" => array:2 [
      "adapter" => "Laminas\Cache\Storage\Adapter\Memory"
      "options" => array:1 [
        "namespace" => "DoctrineModule"
      ]
    ]
    "doctrinemodule.cache.filesystem" => array:3 [
      "adapter" => "filesystem"
      "options" => array:3 [
        "namespace" => "DoctrineModule"
        "cache_dir" => "data/DoctrineModule/cache"
        "key_pattern" => "/^[a-z0-9_\+\-\[\]\\$#]*$/Di"
      ]
      "plugins" => array:1 [
        0 => array:1 [
          "name" => "serializer"
        ]
      ]
    ]
    "doctrinemodule.cache.memcached" => array:2 [
      "adapter" => "memcached"
      "options" => array:2 [
        "namespace" => "DoctrineModule"
        "servers" => []
      ]
    ]
    "doctrinemodule.cache.redis" => array:2 [
      "adapter" => "redis"
      "options" => array:2 [
        "namespace" => "DoctrineModule"
        "server" => array:2 [
          "host" => "localhost"
          "post" => 6379
        ]
      ]
    ]
    "FilesystemCacheThreeMinutes" => array:3 [
      "adapter" => "Laminas\Cache\Storage\Adapter\Filesystem"
      "options" => array:2 [
        "cache_dir" => "./data/cache"
        "ttl" => 180
      ]
      "plugins" => array:1 [
        0 => array:2 [
          "name" => "serializer"
          "options" => []
        ]
      ]
    ]
    "FilesystemCache" => array:3 [
      "adapter" => "Laminas\Cache\Storage\Adapter\Filesystem"
      "options" => array:2 [
        "cache_dir" => "./data/cache"
        "ttl" => 3600
      ]
      "plugins" => array:1 [
        0 => array:2 [
          "name" => "serializer"
          "options" => []
        ]
      ]
    ]
    "FilesystemCacheOneDay" => array:3 [
      "adapter" => "Laminas\Cache\Storage\Adapter\Filesystem"
      "options" => array:2 [
        "cache_dir" => "./data/cache"
        "ttl" => 86400
      ]
      "plugins" => array:1 [
        0 => array:2 [
          "name" => "serializer"
          "options" => []
        ]
      ]
    ]
  ]
  "doctrine" => array:17 [
    "cache" => array:5 [
      "apcu" => array:2 [
        "class" => "DoctrineModule\Cache\LaminasStorageCache"
        "instance" => "doctrinemodule.cache.apcu"
      ]
      "array" => array:2 [
        "class" => "DoctrineModule\Cache\LaminasStorageCache"
        "instance" => "doctrinemodule.cache.array"
      ]
      "filesystem" => array:2 [
        "class" => "DoctrineModule\Cache\LaminasStorageCache"
        "instance" => "doctrinemodule.cache.filesystem"
      ]
      "memcached" => array:2 [
        "class" => "DoctrineModule\Cache\LaminasStorageCache"
        "instance" => "doctrinemodule.cache.memcached"
      ]
      "redis" => array:2 [
        "class" => "DoctrineModule\Cache\LaminasStorageCache"
        "instance" => "doctrinemodule.cache.redis"
      ]
    ]
    "authentication" => array:2 [
      "odm_default" => array:4 [
        "objectManager" => "doctrine.documentmanager.odm_default"
        "identityClass" => "Application\Model\User"
        "identityProperty" => "username"
        "credentialProperty" => "password"
      ]
      "orm_default" => array:1 [
        "objectManager" => "doctrine.entitymanager.orm_default"
      ]
    ]
    "authenticationadapter" => array:2 [
      "odm_default" => true
      "orm_default" => true
    ]
    "authenticationstorage" => array:2 [
      "odm_default" => true
      "orm_default" => true
    ]
    "authenticationservice" => array:2 [
      "odm_default" => true
      "orm_default" => true
    ]
    "connection" => array:3 [
      "orm_default" => array:4 [
        "configuration" => "orm_default"
        "eventmanager" => "orm_default"
        "params" => array:8 [
          "host" => "localhost"
          "port" => "3306"
          "user" => "username"
          "password" => "password"
          "dbname" => "database"
          "driver" => "pdo_mysql"
          "primary" => array:7 [
            "driver" => "pdo"
            "host" => "mysql"
            "port" => 3306
            "user" => "root"
            "password" => "root"
            "dbname" => "c369"
            "charset" => "utf8mb4"
          ]
          "replica" => array:1 [
            0 => array:7 [ …7]
          ]
        ]
        "wrapperClass" => "Doctrine\DBAL\Connections\PrimaryReadReplicaConnection"
      ]
      "odm_default" => array:7 [
        "server" => "mongodb"
        "port" => "27017"
        "connectionString" => "mongodb://root:example@mongo:27017/"
        "user" => "root"
        "password" => "example"
        "dbname" => "richkids"
        "options" => array:3 [
          "compressors" => "disabled"
          "gssapiServiceName" => "mongodb"
          "serverSelectionTryOnce" => false
        ]
      ]
      "orm_miniapp" => array:4 [
        "driverClass" => "Doctrine\DBAL\Driver\PDO\MySQL\Driver"
        "eventmanager" => "orm_miniapp"
        "configuration" => "orm_miniapp"
        "params" => array:7 [
          "driver" => "pdo"
          "host" => "mysql"
          "port" => 3306
          "user" => "root"
          "password" => "root"
          "dbname" => "A_Token_Rkt"
          "charset" => "utf8mb4"
        ]
      ]
    ]
    "configuration" => array:3 [
      "orm_default" => array:13 [
        "metadata_cache" => "array"
        "query_cache" => "array"
        "result_cache" => "array"
        "hydration_cache" => "array"
        "driver" => "orm_default"
        "generate_proxies" => true
        "proxy_dir" => "data/DoctrineORMModule/Proxy"
        "proxy_namespace" => "DoctrineORMModule\Proxy"
        "filters" => []
        "datetime_functions" => []
        "string_functions" => array:10 [
          "JSON_EXTRACT" => "Scienta\DoctrineJsonFunctions\Query\AST\Functions\Mysql\JsonExtract"
          "JSON_SET" => "Scienta\DoctrineJsonFunctions\Query\AST\Functions\Mysql\JsonSet"
          "JSON_SEARCH" => "Scienta\DoctrineJsonFunctions\Query\AST\Functions\Mysql\JsonSearch"
          "replace" => "DoctrineExtensions\Query\Mysql\Replace"
          "RAND" => "DoctrineExtensions\Query\Mysql\Rand"
          "MONTH" => "DoctrineExtensions\Query\Mysql\Month"
          "YEAR" => "DoctrineExtensions\Query\Mysql\Year"
          "YEARMONTH" => "DoctrineExtensions\Query\Mysql\Yearmonth"
          "DATE_FORMAT" => "DoctrineExtensions\Query\Mysql\DateFormat"
          "ROUND" => "DoctrineExtensions\Query\Mysql\Round"
        ]
        "numeric_functions" => []
        "second_level_cache" => []
      ]
      "odm_default" => array:18 [
        "metadata_cache" => "array"
        "driver" => "odm_default"
        "generate_proxies" => 3
        "proxy_dir" => "data/DoctrineMongoODMModule/Proxy"
        "proxy_namespace" => "DoctrineMongoODMModule\Proxy"
        "generate_hydrators" => 1
        "hydrator_dir" => "data/DoctrineMongoODMModule/Hydrator"
        "hydrator_namespace" => "DoctrineMongoODMModule\Hydrator"
        "generate_persistent_collections" => 1
        "persistent_collection_dir" => "data/DoctrineMongoODMModule/PersistentCollection"
        "persistent_collection_namespace" => "DoctrineMongoODMModule\PersistentCollection"
        "persistent_collection_factory" => null
        "persistent_collection_generator" => null
        "default_db" => "richkids"
        "filters" => []
        "types" => []
        "logger" => "DoctrineMongoODMModule\Logging\DebugStack"
        "default_document_repository_class_name" => "Doctrine\ODM\MongoDB\Repository\DocumentRepository"
      ]
      "orm_miniapp" => array:2 [
        "driver" => "orm_miniapp"
        "filters" => []
      ]
    ]
    "driver" => array:6 [
      "orm_default" => array:2 [
        "class" => "Doctrine\Persistence\Mapping\Driver\MappingDriverChain"
        "drivers" => array:1 [
          "Admin\Entity" => "Admin_driver"
        ]
      ]
      "odm_default" => array:2 [
        "class" => "Doctrine\Persistence\Mapping\Driver\MappingDriverChain"
        "drivers" => array:1 [
          "Admin\Documents" => "Admin_sdriver"
        ]
      ]
      "Admin_driver" => array:3 [
        "class" => "Doctrine\ORM\Mapping\Driver\AnnotationDriver"
        "cache" => "array"
        "paths" => array:1 [
          0 => "/var/www/Rich_Kids/trunk/main/module/Admin/config/../src/Entity"
        ]
      ]
      "Admin_sdriver" => array:2 [
        "class" => "Doctrine\ODM\MongoDB\Mapping\Driver\AttributeDriver"
        "paths" => array:1 [
          0 => "/var/www/Rich_Kids/trunk/main/module/Admin/config/../src/Documents"
        ]
      ]
      "MiniApp_driver" => array:3 [
        "class" => "Doctrine\ORM\Mapping\Driver\AnnotationDriver"
        "cache" => "array"
        "paths" => array:1 [
          0 => "/var/www/Rich_Kids/trunk/main/config/autoload/../src/MiniApp/Entity"
        ]
      ]
      "orm_miniapp" => array:2 [
        "class" => "Doctrine\ORM\Mapping\Driver\DriverChain"
        "drivers" => array:1 [
          "Admin\MiniApp\Entity" => "MiniApp_driver"
        ]
      ]
    ]
    "entitymanager" => array:2 [
      "orm_default" => array:2 [
        "connection" => "orm_default"
        "configuration" => "orm_default"
      ]
      "orm_miniapp" => array:2 [
        "connection" => "orm_miniapp"
        "configuration" => "orm_miniapp"
      ]
    ]
    "eventmanager" => array:3 [
      "orm_default" => []
      "odm_default" => array:1 [
        "subscribers" => []
      ]
      "orm_miniapp" => []
    ]
    "sql_logger_collector" => array:1 [
      "orm_default" => array:1 [
        "sql_logger" => "mySqlLogger"
      ]
    ]
    "mapping_collector" => array:1 [
      "orm_default" => []
    ]
    "entity_resolver" => array:1 [
      "orm_default" => []
    ]
    "migrations_configuration" => array:1 [
      "orm_default" => array:11 [
        "table_storage" => array:5 [
          "table_name" => "DoctrineMigrationVersions"
          "version_column_name" => "version"
          "version_column_length" => 191
          "executed_at_column_name" => "executedAt"
          "execution_time_column_name" => "executionTime"
        ]
        "migrations_paths" => []
        "migrations" => []
        "all_or_nothing" => false
        "check_database_platform" => true
        "custom_template" => null
        "dependency_factory_services" => []
        "directory" => "/var/www/Rich_Kids/trunk/main/data/Migrations"
        "name" => "Migrations BT"
        "namespace" => "Migrations"
        "table" => "migrations"
      ]
    ]
    "migrations_cmd" => array:13 [
      "current" => []
      "dumpschema" => []
      "diff" => []
      "generate" => []
      "execute" => []
      "latest" => []
      "list" => []
      "migrate" => []
      "rollup" => []
      "status" => []
      "syncmetadatastorage" => []
      "uptodate" => []
      "version" => []
    ]
    "documentmanager" => array:1 [
      "odm_default" => array:3 [
        "connection" => "odm_default"
        "configuration" => "odm_default"
        "eventmanager" => "odm_default"
      ]
    ]
    "mongo_logger_collector" => array:1 [
      "odm_default" => []
    ]
  ]
  "doctrine_factories" => array:13 [
    "cache" => "DoctrineModule\Service\CacheFactory"
    "eventmanager" => "DoctrineModule\Service\EventManagerFactory"
    "driver" => "DoctrineModule\Service\DriverFactory"
    "authenticationadapter" => "DoctrineModule\Service\Authentication\AdapterFactory"
    "authenticationstorage" => "DoctrineModule\Service\Authentication\StorageFactory"
    "authenticationservice" => "DoctrineModule\Service\Authentication\AuthenticationServiceFactory"
    "connection" => "DoctrineORMModule\Service\DBALConnectionFactory"
    "configuration" => "DoctrineORMModule\Service\ConfigurationFactory"
    "entitymanager" => "DoctrineORMModule\Service\EntityManagerFactory"
    "entity_resolver" => "DoctrineORMModule\Service\EntityResolverFactory"
    "sql_logger_collector" => "DoctrineORMModule\Service\SQLLoggerCollectorFactory"
    "mapping_collector" => "DoctrineORMModule\Service\MappingCollectorFactory"
    "migrations_cmd" => "DoctrineORMModule\Service\MigrationsCommandFactory"
  ]
  "form_elements" => array:2 [
    "aliases" => array:3 [
      "objectselect" => "DoctrineModule\Form\Element\ObjectSelect"
      "objectradio" => "DoctrineModule\Form\Element\ObjectRadio"
      "objectmulticheckbox" => "DoctrineModule\Form\Element\ObjectMultiCheckbox"
    ]
    "factories" => array:3 [
      "DoctrineModule\Form\Element\ObjectSelect" => "DoctrineORMModule\Service\ObjectSelectFactory"
      "DoctrineModule\Form\Element\ObjectRadio" => "DoctrineORMModule\Service\ObjectRadioFactory"
      "DoctrineModule\Form\Element\ObjectMultiCheckbox" => "DoctrineORMModule\Service\ObjectMultiCheckboxFactory"
    ]
  ]
  "hydrators" => array:1 [
    "factories" => array:1 [
      "Doctrine\Laminas\Hydrator\DoctrineObject" => "DoctrineMongoODMModule\Service\DoctrineObjectHydratorFactory"
    ]
  ]
  "laminas-developer-tools" => array:3 [
    "profiler" => array:6 [
      "collectors" => array:3 [
        "doctrine.sql_logger_collector.orm_default" => "doctrine.sql_logger_collector.orm_default"
        "doctrine.mapping_collector.orm_default" => "doctrine.mapping_collector.orm_default"
        "odm_default" => "doctrine.mongo_logger_collector.odm_default"
      ]
      "enabled" => true
      "strict" => true
      "flush_early" => false
      "cache_dir" => "data/cache"
      "matcher" => []
    ]
    "toolbar" => array:5 [
      "entries" => array:3 [
        "doctrine.sql_logger_collector.orm_default" => "laminas-developer-tools/toolbar/doctrine-orm-queries"
        "doctrine.mapping_collector.orm_default" => "laminas-developer-tools/toolbar/doctrine-orm-mappings"
        "odm_default" => "laminas-developer-tools/toolbar/doctrine-odm"
      ]
      "enabled" => true
      "auto_hide" => false
      "position" => "bottom"
      "version_check" => false
    ]
    "events" => array:3 [
      "enabled" => true
      "collectors" => []
      "identifiers" => []
    ]
  ]
  "controllers" => array:3 [
    "factories" => array:78 [
      "Application.HomeController" => "Application\Factory\HomeControllerFactory"
      "Application.ExchangegiftController" => "Application\Factory\ExchangegiftControllerFactory"
      "Application.ManagerktController" => "Application\Factory\ManagerktControllerFactory"
      "Application.AgentMarginController" => "Application\Factory\AgentmarginControllerFactory"
      "Application.StudentsController" => "Application\Factory\StudentsControllerFactory"
      "Application.CommunityController" => "Application\Factory\CommunityControllerFactory"
      "Application.CartController" => "Application\Factory\CartControllerFactory"
      "App.CrontabController" => "Application\Factory\CrontabControllerFactory"
      "App.BingxController" => "Application\Factory\BingxControllerFactory"
      "App.WebsocketController" => "Application\Factory\WebsocketControllerFactory"
      "Application.Appkols.CourseController" => "Application\Factory\Appkols\AppcourseControllerFactory"
      "Application.Appkols.PaymentController" => "Application\Factory\Appkols\ApppaymentControllerFactory"
      "Application.Appkols.KolsController" => "Application\Factory\Appkols\AppkolsControllerFactory"
      "Application.Appkols.StudentController" => "Application\Factory\Appkols\AppstudentControllerFactory"
      "Application.Appkols.AppidentifyController" => "Application\Factory\Appkols\AppidentifyControllerFactory"
      "Application.Appkols.GuestController" => "Application\Factory\Appkols\GuestControllerFactory"
      "Application.Appkols.NewsController" => "Application\Factory\Appkols\AppnewsControllerFactory"
      "Application.Appkols.IdentifyController" => "Application\Factory\Appkols\AppidentifyControllerFactory"
      "App.OnchainController" => "Application\Factory\Onchain\OnchainControllerFactory"
      "App.OnchaincrontabController" => "Application\Factory\Onchain\CrontabControllerFactory"
      "App.CryptoController" => "Application\Factory\Crypto\CryptoControllerFactory"
      "App.MacroController" => "Application\Factory\Macro\MacroControllerFactory"
      "Admin.AuthController" => "Admin\Factory\Auth\AuthControllerFactory"
      "Admin.SystemIndexController" => "Admin\Factory\System\IndexControllerFactory"
      "Admin.SystemUserController" => "Admin\Factory\System\UserControllerFactory"
      "Admin.NewsController" => "Admin\Factory\App\NewsControllerFactory"
      "Admin.PageController" => "Admin\Factory\App\PageControllerFactory"
      "Admin.SeoController" => "Admin\Factory\App\SeoControllerFactory"
      "Admin.AdsController" => "Admin\Factory\App\AdsControllerFactory"
      "Admin.PopupController" => "Admin\Factory\App\PopupControllerFactory"
      "Admin.AppProductController" => "Admin\Factory\App\AppProductControllerFactory"
      "Admin.AppEnrolController" => "Admin\Factory\App\AppEnrolControllerFactory"
      "Admin.AppPaymentController" => "Admin\Factory\App\AppPaymentControllerFactory"
      "Admin.KolsController" => "Admin\Factory\Kols\KolsControllerFactory"
      "Admin.PaymentController" => "Admin\Factory\Kols\PaymentControllerFactory"
      "Admin.CourseController" => "Admin\Factory\Kols\CourseControllerFactory"
      "Admin.StudentController" => "Admin\Factory\Kols\StudentControllerFactory"
      "Admin.ReportController" => "Admin\Factory\Kols\ReportControllerFactory"
      "Admin.CateController" => "Admin\Factory\Kols\CateControllerFactory"
      "Admin.AdminminerController" => "Admin\Factory\Onchain\AdminminerControllerFactory"
      "Admin.AdminonchainController" => "Admin\Factory\Onchain\AdminonchainControllerFactory"
      "Admin.AdminmacroController" => "Admin\Factory\Macro\AdminmacroControllerFactory"
      "Admin.SystemController" => "Admin\Factory\System\SystemControllerFactory"
      "Admin.BotController" => "Admin\Factory\Crypto\BotControllerFactory"
      "Admin.LiquidityController" => "Admin\Factory\Crypto\LiquidityControllerFactory"
      "Admin.CompetitionController" => "Admin\Factory\Crypto\CompetitionControllerFactory"
      "Admin.RktmonthController" => "Admin\Factory\Crypto\RktmonthControllerFactory"
      "Admin.WyckoffController" => "Admin\Factory\Crypto\WyckoffControllerFactory"
      "Admin.AdminmanagerktController" => "Admin\Factory\Rkt\AdminmanagerktControllerFactory"
      "Restful\Controller\General\FeelController" => "Restful\Factory\General\FeelControllerFactory"
      "Restfull.Controller.Kols.UserController" => "Restful\Factory\Kols\UserControllerFactory"
      "Restful\Controller\Kols\NewsController" => "Restful\Factory\Kols\NewsControllerFactory"
      "Restful\Controller\Kols\ApicourseController" => "Restful\Factory\Kols\ApicourseControllerFactory"
      "Restful\Controller\Kols\ApikolsController" => "Restful\Factory\Kols\ApikolsControllerFactory"
      "Restful\Controller\Kols\ApicartController" => "Restful\Factory\Kols\ApicartControllerFactory"
      "Restful\Controller\Onchain\ApionchainController" => "Restful\Factory\Onchain\ApionchainControllerFactory"
      "Restful\Controller\Kols\CateController" => "Restful\Factory\Kols\CateControllerFactory"
      "Restful\Controller\Kols\CommentController" => "Restful\Factory\Kols\CommentControllerFactory"
      "Restful\Controller\Kols\ApistudentController" => "Restful\Factory\Kols\ApistudentControllerFactory"
      "Restful\Controller\Kols\ApitelegramController" => "Restful\Factory\Kols\ApitelegramControllerFactory"
      "Restful\Controller\Kols\ReviewCourseController" => "Restful\Factory\Kols\ReviewCourseControllerFactory"
      "Restful\Controller\Crypto\ExchangeController" => "Restful\Factory\Crypto\ExchangeControllerFactory"
      "Restful\Controller\Crypto\FeelmainController" => "Restful\Factory\Crypto\FeelmainControllerFactory"
      "Restful\Controller\Crypto\EconomicController" => "Restful\Factory\Crypto\EconomicControllerFactory"
      "Restful\Controller\Crypto\ApicompetitionController" => "Restful\Factory\Crypto\ApicompetitionControllerFactory"
      "Restful\Controller\Crypto\ApietfController" => "Restful\Factory\Crypto\ApietfControllerFactory"
      "Restful\Controller\Macro\ApimacroController" => "Restful\Factory\Macro\ApimacroControllerFactory"
      "Restful\Controller\General\GptController" => "Restful\Factory\General\GptControllerFactory"
      "Restful\Controller\General\SystemnewsController" => "Restful\Factory\General\SystemnewsControllerFactory"
      "Restful\Controller\General\AdsController" => "Restful\Factory\General\AdsControllerFactory"
      "Restful\Controller\General\TelegramController" => "Restful\Factory\General\TelegramControllerFactory"
      "Restful\Controller\General\CoinmarketController" => "Restful\Factory\General\CoinmarketControllerFactory"
      "Restful\Controller\Default\GptController" => "Restful\Factory\General\GptControllerFactory"
      "Restful\Controller\General\NotificationController" => "Restful\Factory\General\NotificationControllerFactory"
      "Restful\Controller\General\LiquidityController" => "Restful\Factory\General\LiquidityControllerFactory"
      "Restful\Controller\General\ApipaymentController" => "Restful\Factory\General\ApipaymentControllerFactory"
      "Restful\Controller\ExchangeGift\DashboardController" => "Restful\Factory\ExchangeGift\DashboardControllerFactory"
      "Restful\Controller\ExchangeGift\ExchangegiftController" => "Restful\Factory\ExchangeGift\ExchangegiftControllerFactory"
    ]
    "invokables" => array:1 [
      "Admin\Controller\System\IndexController" => "Admin\Controller\System\IndexController"
    ]
    "aliases" => array:26 [
      "index" => "Admin.SystemIndexController"
      "masteruser" => "Admin.SystemUserController"
      "kolsadmin" => "Admin.KolsController"
      "paymentadmin" => "Admin.PaymentController"
      "courseadmin" => "Admin.CourseController"
      "studentadmin" => "Admin.StudentController"
      "reportadmin" => "Admin.ReportController"
      "cateadmin" => "Admin.CateController"
      "adminminer" => "Admin.AdminminerController"
      "adminonchain" => "Admin.AdminonchainController"
      "adminmacro" => "Admin.AdminmacroController"
      "searchsystem" => "Admin.SystemController"
      "bottelegram" => "Admin.BotController"
      "news" => "Admin.NewsController"
      "apppage" => "Admin.PageController"
      "appseo" => "Admin.SeoController"
      "appads" => "Admin.AdsController"
      "appproduct" => "Admin.AppProductController"
      "appenrols" => "Admin.AppEnrolController"
      "apppayment" => "Admin.AppPaymentController"
      "liquidity" => "Admin.LiquidityController"
      "competition" => "Admin.CompetitionController"
      "popup" => "Admin.PopupController"
      "rktmonth" => "Admin.RktmonthController"
      "wyckoff" => "Admin.WyckoffController"
      "adminmanagerkt" => "Admin.AdminmanagerktController"
    ]
  ]
  "session_containers" => array:3 [
    0 => "Coin369Application"
    1 => "Coin369Application"
    2 => "Coin369Application"
  ]
  "access_filter" => array:2 [
    "options" => array:1 [
      "mode" => "permissive"
    ]
    "controllers" => array:75 [
      "index" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Admin.master"
        ]
      ]
      "masteruser" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Admin.master"
        ]
      ]
      "news" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Admin.master"
        ]
      ]
      "kolsadmin" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Admin.master"
        ]
      ]
      "paymentadmin" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Admin.master"
        ]
      ]
      "courseadmin" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Admin.master"
        ]
      ]
      "studentadmin" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Admin.master"
        ]
      ]
      "reportadmin" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Admin.master"
        ]
      ]
      "cateadmin" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Admin.master"
        ]
      ]
      "adminminer" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Admin.employee"
        ]
      ]
      "adminonchain" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Admin.employee"
        ]
      ]
      "adminmacro" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Admin.employee"
        ]
      ]
      "searchsystem" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Admin.employee"
        ]
      ]
      "bottelegram" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Admin.employee"
        ]
      ]
      "apppage" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Admin.employee"
        ]
      ]
      "appseo" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Admin.employee"
        ]
      ]
      "appads" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Admin.employee"
        ]
      ]
      "appproduct" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Admin.employee"
        ]
      ]
      "appenrols" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Admin.employee"
        ]
      ]
      "apppayment" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Admin.employee"
        ]
      ]
      "liquidity" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Admin.employee"
        ]
      ]
      "competition" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Admin.employee"
        ]
      ]
      "popup" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Admin.employee"
        ]
      ]
      "rktmonth" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Admin.employee"
        ]
      ]
      "wyckoff" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Admin.employee"
        ]
      ]
      "adminmanagerkt" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Admin.employee"
        ]
      ]
      "Application.HomeController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Application.ExchangegiftController" => array:2 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "exchangegifts"
          ]
          "allow" => "Guest"
        ]
        1 => array:2 [
          "actions" => array:1 [
            0 => "exchangegiftsdashboard"
          ]
          "allow" => "User.adminrkt"
        ]
      ]
      "Application.ManagerktController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Application.CommunityController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Application.CartController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Application.Appkols.CourseController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Application.Appkols.PaymentController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Application.Appkols.KolsController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "User.kols"
        ]
      ]
      "Application.Appkols.StudentController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "User.student"
        ]
      ]
      "Application.Appkols.GuestController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "App.OnchainController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Application.Appkols.NewsController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Application.Appkols.IdentifyController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "App.CrontabController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "App.BingxController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "App.CryptoController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "App.MacroController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "App.WebsocketController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Application.AgentMarginController" => array:2 [
        0 => array:2 [
          "actions" => array:2 [
            0 => "index"
            1 => "login"
          ]
          "allow" => "Guest"
        ]
        1 => array:2 [
          "actions" => array:1 [
            0 => "apijson"
          ]
          "allow" => "Guest"
        ]
      ]
      "Application.StudentsController" => array:2 [
        0 => array:2 [
          "actions" => array:2 [
            0 => "index"
            1 => "login"
          ]
          "allow" => "Guest"
        ]
        1 => array:2 [
          "actions" => array:1 [
            0 => "apijson"
          ]
          "allow" => "Guest"
        ]
      ]
      "Restful\Controller\Default\ProductController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Restful\Controller\Default\GptController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "User.student"
        ]
      ]
      "webservice.crypto" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Restfull.Controller.Kols.UserController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Restful\Controller\Kols\NewsController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Restful\Controller\Kols\ApicourseController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Restful\Controller\Kols\ApikolsController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Restful\Controller\Onchain\ApionchainController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Restful\Controller\Kols\CateController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Restful\Controller\Kols\ApicartController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "User.student"
        ]
      ]
      "Restful\Controller\Crypto\ExchangeController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Restful\Controller\Crypto\FeelmainController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Restful\Controller\Crypto\EconomicController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Restful\Controller\Crypto\ApicompetitionController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Restful\Controller\Crypto\ApietfController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Restful\Controller\Macro\ApimacroController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Restful\Controller\General\SystemnewsController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Restful\Controller\General\AdsController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Restful\Controller\General\TelegramController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Restful\Controller\General\CoinmarketController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Restful\Controller\General\LiquidityController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Restful\Controller\Kols\ApistudentController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "User.student"
        ]
      ]
      "Restful\Controller\Kols\ApitelegramController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "User.student"
        ]
      ]
      "Restful\Controller\Kols\ReviewCourseController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "User.student"
        ]
      ]
      "Restful\Controller\Kols\CommentController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "User.student"
        ]
      ]
      "Restful\Controller\General\NotificationController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "User.student"
        ]
      ]
      "Restful\Controller\General\ApipaymentController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
      "Restful\Controller\ExchangeGift\DashboardController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "User.adminkrt"
        ]
      ]
      "Restful\Controller\ExchangeGift\ExchangegiftController" => array:1 [
        0 => array:2 [
          "actions" => array:1 [
            0 => "*"
          ]
          "allow" => "Guest"
        ]
      ]
    ]
  ]
  "roles" => array:2 [
    "role" => array:6 [
      "Admin.master" => null
      "Admin.employee" => "Admin.master"
      "User.kols" => "Admin.employee"
      "User.adminrkt" => "User.kols"
      "User.student" => "User.adminrkt"
      "Guest" => "User.student"
    ]
    "parent" => array:6 [
      "Admin.master" => null
      "Admin.employee" => "Admin.master"
      "User.kols" => "Admin.employee"
      "User.adminrkt" => "User.kols"
      "User.student" => "User.adminrkt"
      "Guest" => "User.student"
    ]
  ]
  "config_cache_enabled" => false
  "resultCacheLifetime" => 3600
  "elasticsearch" => array:2 [
    "connections" => array:5 [
      "index" => "product"
      "host" => "elasticsearch"
      "port" => "9200"
      "username" => "elastic"
      "password" => "U0oaGAggpBAXDjbo7lZa"
    ]
    "type" => array:1 [
      "ES_CLIENT_MASTER" => "client_master"
    ]
  ]
  "myredis" => array:1 [
    "connection" => array:4 [
      "host" => "redis"
      "port" => 6379
      "timeout" => 500
      "password" => "secret_redis"
    ]
  ]
  "Cache_Redis" => array:3 [
    "database" => 1
    "password" => "secret_redis"
    "server" => array:2 [
      "host" => "redis"
      "port" => 6379
    ]
  ]
  "s3_config" => array:4 [
    "endpoint" => "https://s3.ap-southeast-1.amazonaws.com"
    "key" => "AKIA6PTZEUQZNRATR2FF"
    "secret" => "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"
    "bucket" => "coin369pro"
  ]
  "session_config" => array:2 [
    "cookie_lifetime" => 2678400
    "gc_maxlifetime" => 2678400
  ]
  "session_manager" => array:1 [
    "validators" => []
  ]
  "session_storage" => array:1 [
    "type" => "Laminas\Session\Storage\SessionArrayStorage"
  ]
  "mail_smtp" => array:8 [
    "host" => "mail.coin369.vn"
    "username" => "no-reply@coin369.vn"
    "password" => "Ggjxykiqetcvwxmlu123"
    "username_2" => "info@coin369.vn"
    "password_2" => "voicon@DMCL1987"
    "port" => 465
    "ssl" => "ssl"
    "encoding" => "UTF-8"
  ]
  "googleclient" => array:2 [
    "Key_Google" => "190793134147-93ett5phc86kh7actus8rc0lq32trvgl.apps.googleusercontent.com"
    "Secret_Google" => "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"
  ]
  "coinmarketcap" => array:2 [
    "key" => "48184e31-8fc4-418b-aeea-ba8e83e543a1"
    "domain" => "https://sandbox-api.coinmarketcap.com/"
  ]
  "coinglass" => array:2 [
    "key" => "04c1bef9d007470281ecc87989601b5c"
    "domain" => "https://open-api.coinglass.com/public/v2/"
  ]
  "coinapi" => array:2 [
    "key" => "A01717F1-2F36-49C2-B42A-957F220B12A8"
    "domain" => "https://rest.coinapi.io/"
  ]
  "gpt_key" => "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"
  "api_oklink" => "ed01d17c-3781-4cc0-8b4f-de91b3bea26d"
  "telegram" => array:20 [
    "api_key" => "5861408397:AAFPOZnYFZ5Erc6OMAhRQFpFKkkvCGwLzaI"
    "username" => "coin369_bot"
    "channel_id" => "-1001959763675"
    "admin_id" => "-1001872935434"
    "log_id" => "-1001892714035"
    "hook_url" => "https://4019-58-186-75-9.ngrok-free.app/webservice/notification/hook/"
    "news" => array:3 [
      "api_key" => "6583616608:AAHnwuER1uahXKcwmPTdEm8rcTq_IKCHoAs"
      "username" => "News_Coin369_bot"
      "id_channel" => "-1001926610894"
    ]
    "kols" => array:3 [
      "api_key" => "6043098575:AAF2s8M0L_xTPuTgDy7xKLQIGOslqRt6Mw0"
      "username" => "Kols_Coin369_bot"
      "id_channel" => "-1001835767802"
    ]
    "onchain" => array:3 [
      "api_key" => "6517635552:AAGR7N75KhK_cB1M2BZByEZlDRQrGDTEEv0"
      "username" => "Onchain_Coin369_bot"
      "id_channel" => "-1001716216112"
    ]
    "macro" => array:3 [
      "api_key" => "6429959873:AAGIqz_fJ5OK5hXfC93K0rah9nr9FBaZGo8"
      "username" => "Macro_Coin369_bot"
      "id_channel" => "-1001822948598"
    ]
    "signal" => array:3 [
      "api_key" => "6507615322:AAHasP_sIti2K5yDGZyRq2uriCtpaOtrHT0"
      "username" => "Signal_Coin369_bot"
      "id_channel" => "-1001938578868"
    ]
    "wallet" => array:3 [
      "api_key" => "6445797584:AAHMj8lCdVRjLWI9ICgh-DJishNGYpjQ2rg"
      "username" => "Wallet_Coin369_bot"
      "id_channel" => "-1001698172925"
    ]
    "thigiai" => array:3 [
      "api_key" => "7014624329:AAHZ4oT_E5gI0Vu7Fll4x9Imcb92AZQS7LI"
      "username" => "ThiGiaiRKT_bot"
      "id_channel" => "-1002101936596"
    ]
    "managerkt" => array:3 [
      "api_key" => "7339698250:AAE_mpIqLdQW-pWUTrxlKBbfZps1b-x_Cm8"
      "username" => "managerkt_bot"
      "id_channel" => ""
    ]
    "richkids" => array:3 [
      "api_key" => "7238591742:AAHgIssatzBDDrveheOgFlxCqF1GeX-JSEw"
      "username" => "Richkidstrading_Bot"
      "id_channel" => "-1001120820667"
    ]
    "rkt_bonus" => array:3 [
      "api_key" => "7531501111:AAEwA01T4pXJD4Cbl5WINgC1jI5yAoW9Jko"
      "username" => "richkidstradingbot"
      "id_channel" => "-1001397467226"
    ]
    "dacvu_bot" => array:3 [
      "api_key" => "7698679522:AAFJCIWl_LBTDOAF11chNcxiZ7h64r2nZYI"
      "username" => "DacVu_Bot"
      "id_channel" => "-1001397467226"
    ]
    "ptwop" => array:3 [
      "api_key" => "7006585790:AAGBb2er0WYsiV-CmPLTyR42qX6UWJQ_r6k"
      "username" => "p2pUsdtVnd_bot"
      "id_channel" => "-1002118181546"
    ]
    "rkt_hv_bot" => array:3 [
      "api_key" => "8374832930:AAHDuvWhmi9JfXnGfvjkadGTq-4Vk3Ndffc"
      "username" => "RKT_HV_Bot"
      "id_channel" => "-1002121438587"
    ]
    "congdong_bot" => array:3 [
      "api_key" => "8044400415:AAH7vapHEpsaIduGJ68jli5HNxIHo2b4ekk"
      "username" => "RKT_CD_Bot"
      "id_channel" => "-1001206212318"
    ]
  ]
  "WebSocket" => "ws://192.168.150.116:8080"
  "binance" => array:2 [
    "pay" => "sf7h1m1gwv1hsozzodykvcgvtzulne6pg4auzn6nu0tuug4gg1yafi8yobrrxov2"
    "secret" => "uopck7jr93mmqo8i8dgnvvjf2peyn9cbkrrosgj4gqgkemod28ntqyxcparv1lst"
  ]
  "coinremitter" => array:2 [
    "TCN" => array:3 [
      "coin" => "TCN"
      "api_key" => "$2y$10$91ENrgcTh5Ku/FAUEgkxzeGpj0/JbqKNUmpR.E6aF1OF03YcvQvu6"
      "password" => "buitantin"
    ]
    "BNB" => array:3 [
      "coin" => "BNB"
      "api_key" => "$2y$10$tGXsVj8D2aOMX9h9SqoHwOPaH4zwZTbfqd2bmKRm8451j8xaFyV6S"
      "password" => "voicon@LTKO2023"
    ]
  ]
  "bingx" => array:10 [
    "uid" => "11876694"
    "master" => "20246128"
    "masterman" => "20246128"
    "bep20" => "0xa8e8ce09c735016021cef0012030624c4886c119"
    "trc20" => "TGY7WZtWLHZzCsz2w4U6GGMPvM59kiUhEs"
    "sol" => "DR8jH8v11ULY9ogcfZ5XwLHFdouLbQgbArT8e2FTWyAD"
    "key" => "rAknGLU3pFtDu92s0Ms7QQwVw4mJxiTHy4AjB54UXx9nVCTbhu5AiQkiUJ79DiYfl7QlO9ns6VuD3H23vNacg"
    "secret" => "nFtAByWBvLfcz41becTQXv4E11WFlKtAGt4EpwDSHH1nR3Ggeq2A8Cmu5HeReaiqLWv3B0TFY8zJXji0rMpQ"
    "key_1" => "3fkodNWIfkL3Hf0Qu6EaYOD7o7atWX04Q06C1aYYE75QyQIjOc2BXBhwRELRNPiLcS2LEHJB1Weh3xe7jl4g"
    "secret_1" => "ib44CPH4y1iA0B1jEIe8rzW2WmfqSZnKkVZsdiElHhZAVeJCJEpgcK17r5mvrIDjfCZN7IfO8na7bNMwYUlw"
  ]
  "thumbor" => array:3 [
    "base_url" => "http://localhost:8000"
    "security_key" => "MY_SECURE_KEY_BT"
    "image_url" => "http://localhost:8000/unsafe/300x200/smart/http://example.com/image.jpg"
  ]
  "nixiesearch" => array:3 [
    "base_url" => "http://nixiesearch:8080"
    "timeout" => 5
    "api_key" => "NIXIESEARCHPASSWORD"
  ]
  "ton" => array:4 [
    "isMainnet" => false
    "api_key" => "e68a22e4af1751ee99d3534f824e53f15f936d8dc0092e95c5e8f9514a907a82"
    "V3R2_WALLET_WORDS" => "8J0KRD37+DEVdkeQW0uaOMBzNulzp0xvolQ+T2X5aDMw+SLI/I507Nr5kRZPu5nHWxlZBqz1eaQGF9ZKzRPWvHsR77NQCF4wOUm/iOLGLBHjGKFV3+syU+tuFGH/uPmTZ/phVomm0qvWkC2nCtKtww/HJP+TmJfLkc5zi/S5L1sjmZo3oCjc5k6HlDn37hCrrZ3kyCgSoCZgc/xK9X7Xuw=="
    "hot_wallet" => "0QBQwI295E4I6eOlGX5A_rO46bKaE_CHgYX3K8S_citpfSIB"
  ]
]
Application Config ApplicationConfig
Application Config (ApplicationConfig)
 array:2 [
  "modules" => array:25 [
    0 => "Laminas\Mail"
    1 => "Laminas\DeveloperTools"
    2 => "Laminas\Serializer"
    3 => "Laminas\I18n"
    4 => "Laminas\Mvc\Plugin\FlashMessenger"
    5 => "Laminas\Log"
    6 => "Laminas\Session"
    7 => "Laminas\Cache"
    8 => "Laminas\Paginator"
    9 => "Laminas\Form"
    10 => "Laminas\InputFilter"
    11 => "Laminas\Filter"
    12 => "Laminas\Hydrator"
    13 => "Laminas\Db"
    14 => "Laminas\Router"
    15 => "Laminas\Validator"
    16 => "DoctrineModule"
    17 => "DoctrineORMModule"
    18 => "Laminas\Cache\Storage\Adapter\Filesystem"
    19 => "Laminas\Cache\Storage\Adapter\Memory"
    20 => "DoctrineMongoODMModule"
    21 => "Laminas\Cache\Storage\Adapter\Redis"
    22 => "Application"
    23 => "Admin"
    24 => "Restful"
  ]
  "module_listener_options" => array:7 [
    "use_laminas_loader" => true
    "config_glob_paths" => array:2 [
      0 => "/var/www/Rich_Kids/trunk/main/config/autoload/{{,*.}global,{,*.}local}.php"
      1 => "/var/www/Rich_Kids/trunk/main/config/autoload/{,*.}{global,local}-development.php"
    ]
    "config_cache_enabled" => false
    "config_cache_key" => "dmcl.config.cache"
    "module_map_cache_enabled" => false
    "module_map_cache_key" => "dmcl.module.cache"
    "cache_dir" => "data/cache/"
  ]
]
Database (Laminas\Db) N/A
Error You have to install or enable @bjyoungblood's Laminas\Db Profiler to use this feature.
Doctrine ORM (Queries) 8 queries in 0.00 µs
DoctrineORMModule Queries for doctrine.sql_logger_collector.orm_default
SQL SELECT t0.id AS id_1, t0.setting_value AS setting_value_2, t0.setting_key AS setting_key_3 FROM sys_setting t0 Params Types Time 0
SQL SELECT t0.id AS id_1, t0.name AS name_2, t0.status AS status_3, t0.picture AS picture_4, t0.links AS links_5, t0.order_by AS order_by_6, t0.created_at AS created_at_7, t0.updated_at AS updated_at_8 FROM app_ads t0 WHERE t0.status = ? ORDER BY t0.order_by ASC Params     0 => string(1) "1"
Types     0 => string(6) "string"
Time 0
SQL SELECT t0.id AS id_1, t0.name AS name_2, t0.slug AS slug_3, t0.cid_parent AS cid_parent_4, t0.note AS note_5, t0.status AS status_6, t0.updated_at AS updated_at_7, t0.created_at AS created_at_8 FROM sys_news_cate t0 WHERE t0.status = ? ORDER BY t0.id DESC Params     0 => string(1) "1"
Types     0 => string(6) "string"
Time 0
SQL SELECT t0.id AS id_1, t0.name AS name_2, t0.slug AS slug_3, t0.description AS description_4, t0.content AS content_5, t0.video_url AS video_url_6, t0.picture AS picture_7, t0.viewer AS viewer_8, t0.order_by AS order_by_9, t0.status AS status_10, t0.cid_user AS cid_user_11, t0.cid_cate AS cid_cate_12, t0.cid_cate_child AS cid_cate_child_13, t0.rating AS rating_14, t0.updated_at AS updated_at_15, t0.created_at AS created_at_16, t0.cid_cate AS cid_cate_17, t0.cid_user AS cid_user_18 FROM sys_news t0 WHERE t0.slug = ? LIMIT 1 Params     0 => string(87) "tho-dao-bitcoin-rut-485-trieu-usd-khi-btc-chat-vat-giu-muc-112000-usd-dau-hieu-canh-bao"
Types     0 => string(6) "string"
Time 0
SQL SELECT t0.id AS id_1, t0.name AS name_2, t0.slug AS slug_3, t0.description AS description_4, t0.content AS content_5, t0.video_url AS video_url_6, t0.picture AS picture_7, t0.viewer AS viewer_8, t0.order_by AS order_by_9, t0.status AS status_10, t0.cid_user AS cid_user_11, t0.cid_cate AS cid_cate_12, t0.cid_cate_child AS cid_cate_child_13, t0.rating AS rating_14, t0.updated_at AS updated_at_15, t0.created_at AS created_at_16, t0.cid_cate AS cid_cate_17, t0.cid_user AS cid_user_18 FROM sys_news t0 WHERE t0.status = ? ORDER BY t0.id DESC LIMIT 9 Params     0 => string(1) "1"
Types     0 => string(6) "string"
Time 0
SQL SELECT t0.id AS id_1, t0.name AS name_2, t0.username AS username_3, t0.password AS password_4, t0.email AS email_5, t0.uid_bingx AS uid_bingx_6, t0.phone AS phone_7, t0.address AS address_8, t0.note AS note_9, t0.ref_kols AS ref_kols_10, t0.code_login AS code_login_11, t0.is_check_login AS is_check_login_12, t0.telegram AS telegram_13, t0.telegram_init AS telegram_init_14, t0.role AS role_15, t0.google_id AS google_id_16, t0.facebook_id AS facebook_id_17, t0.login_session AS login_session_18, t0.login_session_time AS login_session_time_19, t0.social_network AS social_network_20, t0.status AS status_21, t0.description AS description_22, t0.is_instructor AS is_instructor_23, t0.thumbnail AS thumbnail_24, t0.limit_video AS limit_video_25, t0.security_code AS security_code_26, t0.log_email AS log_email_27, t0.updated_at AS updated_at_28, t0.created_at AS created_at_29 FROM kols_user t0 WHERE t0.id = ? Params     0 => int(1)
Types     0 => string(6) "string"
Time 0
SQL SELECT t0.id AS id_1, t0.name AS name_2, t0.slug AS slug_3 FROM sys_tags t0 INNER JOIN sys_tags_news ON t0.id = sys_tags_news.cid_tags WHERE sys_tags_news.cid_news = ? Params     0 => int(2793)
Types     0 => string(6) "string"
Time 0
SQL SELECT a0_.id AS id_0, a0_.path AS path_1, a0_.title AS title_2, a0_.description AS description_3, a0_.keyword AS keyword_4, a0_.facebook_content AS facebook_content_5, a0_.ads_content AS ads_content_6, a0_.schema_content AS schema_content_7, a0_.meta_content AS meta_content_8, a0_.flag_content AS flag_content_9, a0_.is_default AS is_default_10, a0_.updated_at AS updated_at_11, a0_.created_at AS created_at_12 FROM app_seo a0_ WHERE a0_.path LIKE '%/app-news/detail/tho-dao-bitcoin-rut-485-trieu-usd-khi-btc-chat-vat-giu-muc-112000-usd-dau-hieu-canh-bao' ORDER BY a0_.id DESC LIMIT 1 Params Types Time 0
Doctrine ORM (Mappings) 113 mappings
DoctrineORMModule Mappings for doctrine.mapping_collector.orm_default
Admin\Entity\AgentMargin\Margin_Auctions
Admin\Entity\AgentMargin\Margin_Bids
Admin\Entity\AgentMargin\Margin_Fund
Admin\Entity\AgentMargin\Margin_Futures
Admin\Entity\AgentMargin\Margin_Futures_Bonus
Admin\Entity\AgentMargin\Margin_Futures_Import
Admin\Entity\AgentMargin\Margin_Futures_LuckyDraw
Admin\Entity\AgentMargin\Margin_Futures_Month
Admin\Entity\AgentMargin\Margin_Futures_Setup
Admin\Entity\AgentMargin\Margin_History_Trader
Admin\Entity\AgentMargin\Margin_User
Admin\Entity\Api\Arkham
Admin\Entity\Api\Coingecko
Admin\Entity\Api\Coinglass
Admin\Entity\Api\Coinmarketcap
Admin\Entity\App\Ads
Admin\Entity\App\AppEnrols
Admin\Entity\App\AppPayment
Admin\Entity\App\AppProduct
Admin\Entity\App\Page
Admin\Entity\App\PaymentOnchain
Admin\Entity\App\PaymentProcess
Admin\Entity\App\PaymentSession
Admin\Entity\App\Popup
Admin\Entity\App\Seo
Admin\Entity\BC\Address
Admin\Entity\BC\Invoice
Admin\Entity\Bot\Macro
Admin\Entity\Bot\Onchain
Admin\Entity\Bot\Signal
Admin\Entity\Bot\Wallet
Admin\Entity\Crypto\BotChat
Admin\Entity\Crypto\BotTelegram
Admin\Entity\Crypto\Calendar
Admin\Entity\Crypto\CalendarEvent
Admin\Entity\Crypto\Coutry
Admin\Entity\Crypto\Etf
Admin\Entity\Crypto\Liquidity
Admin\Entity\ExchangeGift\ExchangeGift_Detail_Order
Admin\Entity\ExchangeGift\ExchangeGift_Order
Admin\Entity\ExchangeGift\ExchangeGift_Product
Admin\Entity\Gift\GiftCate
Admin\Entity\Gift\GiftProduct
Admin\Entity\Hb\Hb_Alert
Admin\Entity\Hb\Hb_Gann
Admin\Entity\Kols\Cate
Admin\Entity\Kols\Course
Admin\Entity\Kols\Enrols
Admin\Entity\Kols\Kolscoursecate
Admin\Entity\Kols\Lesson
Admin\Entity\Kols\Member
Admin\Entity\Kols\News
Admin\Entity\Kols\Newscate
Admin\Entity\Kols\Payment
Admin\Entity\Kols\Paymentdetail
Admin\Entity\Kols\Report
Admin\Entity\Kols\Reviewmarket
Admin\Entity\Kols\Section
Admin\Entity\Kols\Tag
Admin\Entity\Kols\User
Admin\Entity\Kols\Usernetwork
Admin\Entity\Kols\Wishlist
Admin\Entity\Macro\CateMacro
Admin\Entity\Macro\ProductMacro
Admin\Entity\Macro\WcMacro
Admin\Entity\ManageRkt\MR_Channel
Admin\Entity\ManageRkt\MR_Icon
Admin\Entity\ManageRkt\MR_KPI
Admin\Entity\ManageRkt\MR_Message
Admin\Entity\ManageRkt\MR_Money
Admin\Entity\ManageRkt\MR_Promotion
Admin\Entity\ManageRkt\MR_ReportMonth
Admin\Entity\ManageRkt\MR_Sales
Admin\Entity\ManageRkt\MR_Setting
Admin\Entity\ManageRkt\MR_User
Admin\Entity\Notification\NotificationArkham
Admin\Entity\Notification\NotificationKols
Admin\Entity\Notification\NotificationMacro
Admin\Entity\Notification\NotificationNews
Admin\Entity\Notification\NotificationOnchain
Admin\Entity\Notification\NotificationSignal
Admin\Entity\Notification\NotificationSignalChannel
Admin\Entity\Notification\NotificationWallet
Admin\Entity\Onchain\CateOnchain
Admin\Entity\Onchain\PriceBitcoin
Admin\Entity\Onchain\ProductOnchain
Admin\Entity\Onchain\ResultOnchain
Admin\Entity\Ref\Ref_Channel
Admin\Entity\Ref\Ref_Log_Bingx
Admin\Entity\Ref\Ref_Referrals
Admin\Entity\Ref\Ref_Users
Admin\Entity\Rkt\RktBingxPayment
Admin\Entity\Rkt\RktCheckPrice
Admin\Entity\Rkt\RktCompetition
Admin\Entity\Rkt\RktMonth
Admin\Entity\Rkt\RktUser
Admin\Entity\Rkt\RktUserHistory
Admin\Entity\Rkt\RktUserRef
Admin\Entity\Rkt\RktWyckoff
Admin\Entity\Students\Students_Coin
Admin\Entity\Students\Students_Flag
Admin\Entity\Students\Students_Signal_Rkt
Admin\Entity\Students\Students_User
Admin\Entity\System\Application
Admin\Entity\System\Setting
Admin\Entity\System\SysNews
Admin\Entity\System\SysNewscate
Admin\Entity\System\SysTags
Admin\Entity\Wallet\WalletAddress
Admin\Entity\Wallet\WalletCoin
Admin\Entity\Wallet\WalletHold
Admin\Entity\Wallet\WalletSendMessage
Admin\Entity\Wallet\WalletTransaction
MongoDB (DoctrineMongoODMModule) 0 queries
Details Help us! Please help us improve
profiling by forking and
contributing to
DoctrineMongoODMModule
Queries for odm_default